DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mcad and Acox57D-d

DIOPT Version :9

Sequence 1:NP_648149.1 Gene:Mcad / 38864 FlyBaseID:FBgn0035811 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_523803.1 Gene:Acox57D-d / 37446 FlyBaseID:FBgn0034629 Length:677 Species:Drosophila melanogaster


Alignment Length:358 Identity:87/358 - (24%)
Similarity:132/358 - (36%) Gaps:110/358 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 GNKEQKKKYLGRLLEE-PLVAAYCVTEPGAGSDVSGIKTRA--EKKGDEWVIN-----GQKMWIT 189
            |..||.:|: |:..|. .::..|..||...|::|.|:.|||  :.|.||:|:|     ..|.|  
  Fly   135 GTAEQVEKW-GKAAENCNIIGTYAQTELAHGTNVRGLATRADFDPKTDEFVLNTPNLEAYKWW-- 196

  Fly   190 NGGV---ANWYFVLARTNPDPKCPPSKAFTG---FIVE-RDS------PGLTPGR--KELNMGQR 239
            .||:   ||...|:|:..      .:....|   |||. |||      ||:..|.  |:|.|   
  Fly   197 PGGLGHTANHAMVVAQLY------IADVHHGVQMFIVPLRDSETHMPLPGVDIGEIGKKLGM--- 252

  Fly   240 ASDTRG-ITFEDVRVPKENVLIGEGAGFKIAM----GTFDKTRPPVAAGAVGLA-QRCL------ 292
            ||..:| :....||:|:.|:|:      |.|.    ||| |..|......:.:. .|||      
  Fly   253 ASVNQGFLGLNHVRIPRTNMLM------KFAKVERDGTF-KASPASRINYLTMVYTRCLIVSQNS 310

  Fly   293 -------DEALKYALERK-------------------------TFGVPIAYHQAVQFMLADMAIG 325
                   ..|.:|:..|:                         .....||||.|.::|       
  Fly   311 TLLLAAATIATRYSAVRRQSPIEPNQPEPQIIDHVTQRLKLFPEIATGIAYHLATEYM------- 368

  Fly   326 VETSRLAWRLSAWEIDQGRRNSYYASIAKCHAADMANKI--ASDAVQ-------IFGGNGFNSEY 381
                   |.:.|..: |...|..:..:...|....|.|:  .:|...       ..||:|:....
  Fly   369 -------WEMYAQTV-QEANNGKFERLPDMHILSCALKVLCTTDGCAGIEKLRLSTGGHGYLIAA 425

  Fly   382 PVEKLMRDAKIYQIYEGTSQIQRLIISRNMYEA 414
            .:..:..:|.....|||.:.:..|.|.|.:.:|
  Fly   426 NLSNIYGNAVAAYTYEGENTVLLLQIGRALVKA 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
McadNP_648149.1 CaiA 35..411 CDD:224871 86/353 (24%)
MCAD 37..414 CDD:173846 86/356 (24%)
Acox57D-dNP_523803.1 ACAD 14..653 CDD:299127 87/358 (24%)
PLN02443 16..677 CDD:178062 87/358 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460788
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.