DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mcad and CG17544

DIOPT Version :9

Sequence 1:NP_648149.1 Gene:Mcad / 38864 FlyBaseID:FBgn0035811 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_001163015.1 Gene:CG17544 / 35213 FlyBaseID:FBgn0032775 Length:693 Species:Drosophila melanogaster


Alignment Length:388 Identity:80/388 - (20%)
Similarity:141/388 - (36%) Gaps:88/388 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 IPADIGGLDLDVFTTCLSAEELAYGCTGIMTALE-ASGLGQ-TPVILSGNKEQKKKYLGRLLEEP 149
            :|.:|..|.....|..|.....|..|.....::: |.|:|. ...|.:...|:.:||:.......
  Fly    87 VPKEIESLSFSAKTKYLMYINEALACYSPSLSVKIALGVGLFNNAIRAMGTEKHQKYIEAAWNRE 151

  Fly   150 LVAAYCVTEPGAGSDVSGIKTRA--EKKGDEWVIN-----GQKMWITNGG--------VANWYFV 199
            ::....:||...||:...|:|.|  :....|:|||     ..|.|:.|.|        .||.|..
  Fly   152 VITCLAITELSHGSNTKSIRTTATYDPTTQEFVINTPDFEAAKCWVGNLGKTATVAMTFANLYTA 216

  Fly   200 LARTNPDPKCPPSKAFTGFIVE-RDS------PGLTPGRKELNMGQRASDTRGITFEDVRVPKEN 257
            ..:.:         ...||::. ||.      ||:..|......|....|...:.|.:.|:|::|
  Fly   217 DGQNH---------GLHGFLIPIRDPKTLLSYPGVLVGDIGEKCGLNGIDNGFVVFTNYRIPRDN 272

  Fly   258 VL------IGEGAGFKI----------AMGTFDKTRPPVAAGAVGLAQRCLDE-------ALKYA 299
            :|      ..||....:          |:.:|       :||.:|:.|...:.       |::|:
  Fly   273 LLNRTSDVTPEGVYESVFTEPGKVLGAALESF-------SAGRIGIMQESANTLCSAAVIAVRYS 330

  Fly   300 LERKTFG-------VPIAYHQAVQFMLADMAIGVETSRLAWR---------LSAWEIDQGRRNSY 348
            ..||.||       :.|..:|..|:.:..........::|..         ::..:.|....:..
  Fly   331 AVRKQFGPERHGEEMAILEYQLHQYRIFPYLAAACVQKIATEELTSTYMEIIARSQADSNGFDVL 395

  Fly   349 YASIAKCHAADMANK-----IASDAVQ----IFGGNGFNSEYPVEKLMRDAKIYQIYEGTSQI 402
            ..:.|:.||...::|     .|.||:|    ..||:|:.....:.::..|......|||.:.:
  Fly   396 TQNAAEIHALISSSKPLITWAARDAIQEAREACGGHGYLQAAKLGQMRTDHDPLCTYEGDNNV 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
McadNP_648149.1 CaiA 35..411 CDD:224871 80/388 (21%)
MCAD 37..414 CDD:173846 80/388 (21%)
CG17544NP_001163015.1 AXO 16..670 CDD:173839 80/388 (21%)
PLN02443 18..687 CDD:178062 80/388 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.