DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mcad and CG9547

DIOPT Version :9

Sequence 1:NP_648149.1 Gene:Mcad / 38864 FlyBaseID:FBgn0035811 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_609040.1 Gene:CG9547 / 33911 FlyBaseID:FBgn0031824 Length:419 Species:Drosophila melanogaster


Alignment Length:436 Identity:128/436 - (29%)
Similarity:198/436 - (45%) Gaps:63/436 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LNKLAAPALRQLVSQSRAYAA--VSHVSPNGTSFALTEDQLQLQELARKFTREEIIPVAAQYDKS 66
            ::|| .|..|:|.|.|...||  .:...|......|||:::.:::..|.:.:.|:          
  Fly     7 ISKL-RPCARRLASTSSKAAAPKFNWQDPLNLESQLTEEEVAIRDAFRGYCQAEL---------- 60

  Fly    67 GEYPWPIIKKAWELGLMNNHIPADIGGLDLDVFTTCLSAEELAYGCTGIMTALEA---------- 121
                .|.:|.|..|...:..|..:||.|.:      |......|||.|:.:....          
  Fly    61 ----QPRVKMANRLETFDKKIMEEIGSLGV------LGCTIKGYGCAGVSSVAYGLLTREVERVD 115

  Fly   122 ----------SGLGQTPVILSGNKEQKKKYLGRLLEEPLVAAYCVTEPGAGSDVSGIKTRA--EK 174
                      |.|....:...|::|||::||..:.|..|:.|:.:|||..|||.:|::|||  :.
  Fly   116 SAYRSAVSVQSSLAMGAIYDFGSEEQKQRYLPSMAEGKLIGAFGLTEPNHGSDPAGMETRAKYDS 180

  Fly   175 KGDEWVINGQKMWITNGGVANWYFVLARTNPDPKCPPSKAFTGFIVER--DSPGLTPGRKELNMG 237
            |...:::||.|.|||:..:|:...|.|      ||...|. .||:|:|  ...||...:.|....
  Fly   181 KSKTYILNGSKTWITSAPIADVIVVWA------KCEDGKV-RGFLVDRKISGKGLETPKIEGKFS 238

  Fly   238 QRASDTRGITFEDVRVPKENVLIGEGAGFKIAMGTFDKTRPPVAAGAVGLAQRCLDEALKYALER 302
            .|||.|..|..::||||:|. |:...|||.......:..|..:|.||:|.|:.|::.|.:|.|:|
  Fly   239 LRASPTGMILMDEVRVPEEQ-LLPNVAGFSGPFSCLNNARYGIAWGALGAAETCVEIARQYTLDR 302

  Fly   303 KTFGVPIAYHQAVQFMLAD----MAIGVETSRLAWRLSAWEIDQGRRNSYYASIAKCHAADMANK 363
            |.||.|:|.:|.:|..|||    :|:|::......||.    ||........|:.|.:....:..
  Fly   303 KQFGRPLAANQLIQKKLADAITEIALGLQACLHVGRLK----DQKLHTPDMISLLKRNNTGKSLD 363

  Fly   364 IASDAVQIFGGNGFNSEYPVEKLMRDAKIYQIYEGTSQIQRLIISR 409
            ||.....:.|.||.:.||.|.:.:.:.:....||||..|..||:.|
  Fly   364 IARQMRDMLGANGISDEYHVIRHVINLESVNTYEGTHDIHALILGR 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
McadNP_648149.1 CaiA 35..411 CDD:224871 118/403 (29%)
MCAD 37..414 CDD:173846 118/401 (29%)
CG9547NP_609040.1 GCD 29..417 CDD:173840 119/413 (29%)
CaiA 41..417 CDD:224871 118/401 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460781
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D589058at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.