DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mcad and ACAD8

DIOPT Version :9

Sequence 1:NP_648149.1 Gene:Mcad / 38864 FlyBaseID:FBgn0035811 Length:419 Species:Drosophila melanogaster
Sequence 2:XP_024304205.1 Gene:ACAD8 / 27034 HGNCID:87 Length:493 Species:Homo sapiens


Alignment Length:371 Identity:122/371 - (32%)
Similarity:196/371 - (52%) Gaps:15/371 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LRQLVSQSRAYAAVSHVSPNGTSFALTEDQLQLQELARKFTREEIIPVAAQYDKSGEYPWPIIKK 76
            ||.|| |:...:..|.:.|   |..|.|:|.:.|::|..|...|:.|..|::|:...:|..:::|
Human    20 LRVLV-QTGHRSLTSCIDP---SMGLNEEQKEFQKVAFDFAAREMAPNMAEWDQKELFPVDVMRK 80

  Fly    77 AWELGLMNNHIPADIGGLDLDVFTTCLSAEELAYGCTGIMTALEASGLGQTPVILSGNKEQKKKY 141
            |.:||....:|..|:||..|....|.:..|.||.|||.....:....:....:...||:||:.|:
Human    81 AAQLGFGGVYIQTDVGGSGLSRLDTSVIFEALATGCTSTTAYISIHNMCAWMIDSFGNEEQRHKF 145

  Fly   142 LGRLLEEPLVAAYCVTEPGAGSDVSGIKTRAEKKGDEWVINGQKMWITNGGVANWYFVLART-NP 205
            ...|......|:||:||||:|||.:.:.|.|:|:||.:::||.|.:|:..|.::.|.|:.|| .|
Human   146 CPPLCTMEKFASYCLTEPGSGSDAASLLTSAKKQGDHYILNGSKAFISGAGESDIYVVMCRTGGP 210

  Fly   206 DPKCPPSKAFTGFIVERDSPGLTPGRKELNMGQRASDTRGITFEDVRVPKENVLIGEGAGFKIAM 270
            .|     |..:..:||:.:|||:.|:||..:|..:..||.:.|||..||..|.:..||.||.||:
Human   211 GP-----KGISCIVVEKGTPGLSFGKKEKKVGWNSQPTRAVIFEDCAVPVANRIGSEGQGFLIAV 270

  Fly   271 GTFDKTRPPVAAGAVGLAQRCLDEALKYALERKTFGVPIAYHQAVQFMLADMAIGVETSRLAWRL 335
            ...:..|..:|:.::|.|...:.....:...||.||.|:|.:|.:||.|||||..:..:||..|.
Human   271 RGLNGGRINIASCSLGAAHASVILTRDHLNVRKQFGEPLASNQYLQFTLADMATRLVAARLMVRN 335

  Fly   336 SAWEIDQGRRNSY-YASIAKCHAADMANKIASDAVQIFGGNGFNSE 380
            :|..:.:.|:::. ..|:||..|.|....::..:    |..|.:.|
Human   336 AAVALQEERKDAVALCSMAKLFATDECFAVSDSS----GSPGMDRE 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
McadNP_648149.1 CaiA 35..411 CDD:224871 114/348 (33%)
MCAD 37..414 CDD:173846 114/346 (33%)
ACAD8XP_024304205.1 IBD 41..387 CDD:173851 114/346 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D281661at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.