DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mcad and Acox2

DIOPT Version :9

Sequence 1:NP_648149.1 Gene:Mcad / 38864 FlyBaseID:FBgn0035811 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_665713.2 Gene:Acox2 / 252898 RGDID:628684 Length:681 Species:Rattus norvegicus


Alignment Length:419 Identity:89/419 - (21%)
Similarity:154/419 - (36%) Gaps:102/419 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 TREEIIPVAAQYDKSGEYPWPIIKKAWELG--------LMNNHIPADIGGLDLDVFTTCLSAEEL 108
            ||||:      |:.:.:..:.:.|.||.||        :..|.:      ||.:|          
  Rat    72 TREEL------YEDAIQKRFHLEKLAWSLGWSEDGPERIYANRV------LDGNV---------- 114

  Fly   109 AYGCTGIMTALEASGLGQTPVILSGNKEQKKKYLGRLLEE-PLVAAYCVTEPGAGSDVSGIKTRA 172
                     .|...|:....:...|:.||..|: |:|.:. .::..|..||.|.|:.:.|::|.|
  Rat   115 ---------NLSLHGVAMNAIRSLGSDEQIAKW-GQLCKNFQIITTYAQTELGHGTYLQGLETEA 169

  Fly   173 --EKKGDEWVINGQKMWITN--GGVANWYFVLARTNPDPKCPPSK-AFTGFIVERDS-------P 225
              ::...|:||:...|..|.  .|...|....|.......|...: ....|||...|       |
  Rat   170 TYDEARQEFVIHSPTMTSTKWWPGDLGWSVTHAVVLAQLTCLGVRHGMHAFIVPIRSLEDHTPLP 234

  Fly   226 GLTPGRKELNMGQRASDTRGITFEDVRVPKENVLIGEGAGFKIAM--GTFDKTRPP--------- 279
            |:|.|.....||....|...:....||||:||:|    :.|...:  ||:.:...|         
  Rat   235 GITVGDIGPKMGLEHIDNGFLQLNHVRVPRENML----SRFAEVLPDGTYQRLGTPQSNYLGMLV 295

  Fly   280 -----VAAGAVGLAQRCLDEALKYALERKTFGVP--------IAYHQAVQFMLADMAIGVETSRL 331
                 :..|.:...|:....|.:|::.|....:.        :.|....|.:|..:|:.     .
  Rat   296 TRVQLLCKGILPSLQKACIIATRYSVIRHQSRLRPSDPEAKILEYQTQQQKLLPQLAVS-----Y 355

  Fly   332 AWRLSAWEIDQGRRNSY-------YASIAKCHA---------ADMANKIASDAVQIFGGNGFNSE 380
            |:..:|..:.:...:||       ::.:.:.||         ||...:.|....:..||:|::..
  Rat   356 AFHFTATSLSEFFHSSYSAILKRDFSLLPELHALSTGMKATFADFCAQGAEICRRACGGHGYSKL 420

  Fly   381 YPVEKLMRDAKIYQIYEGTSQIQRLIISR 409
            ..:..|:..|.....|||.:.:..|.::|
  Rat   421 SGLPTLVARATASCTYEGENTVLYLQVAR 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
McadNP_648149.1 CaiA 35..411 CDD:224871 89/419 (21%)
MCAD 37..414 CDD:173846 89/419 (21%)
Acox2NP_665713.2 AXO 20..655 CDD:173839 89/419 (21%)
Microbody targeting signal. /evidence=ECO:0000255 679..681
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.