DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mcad and Acox1

DIOPT Version :9

Sequence 1:NP_648149.1 Gene:Mcad / 38864 FlyBaseID:FBgn0035811 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_001258827.1 Gene:Acox1 / 11430 MGIID:1330812 Length:661 Species:Mus musculus


Alignment Length:344 Identity:82/344 - (23%)
Similarity:140/344 - (40%) Gaps:88/344 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PALRQLVSQSRAYAA-----VSHV---SPNGT-------SFALTEDQLQLQELARKFTREEIIPV 59
            |.||    :.||.|.     ::|:   ||..|       :..|.:...|.::. ...||.:...|
Mouse     3 PDLR----KERAAATFNPELITHILDGSPENTRRRREIENLILNDPDFQHEDY-NFLTRSQRYEV 62

  Fly    60 AAQYDKSGEYPWPIIKKAWELGLMNNHIPADIGGLDLDVFTTCLSAEELAYGCTGIMTALEASGL 124
            |.:  ||.    .::||..|.|:.:   |.:|                :.:....::..:|..||
Mouse    63 AVK--KSA----TMVKKMREFGIAD---PEEI----------------MWFKKLHMVNFVEPVGL 102

  Fly   125 GQT---PVILS-GNKEQKKKYLGRLLEEPLVAAYCVTEPGAGSDVSGIKTRA--EKKGDEWVING 183
            ..:   |.:|: |...|::|::....|..::..|..||.|.|:.:.|::|.|  :.|..|:::|.
Mouse   103 NYSMFIPTLLNQGTTAQQEKWMHPSQELQIIGTYAQTEMGHGTHLRGLETTATYDPKTQEFILNS 167

  Fly   184 Q-----KMWITNGGV---ANWYFVLARTNPDPKCPPSKAFTGFIVE----RDSPGLTPGRKELNM 236
            .     |.|  .||:   :|...|||:.....:|....||...|.|    :..||:|.|......
Mouse   168 PTVTSIKWW--PGGLGKTSNHAIVLAQLITRGECYGLHAFVVPIREIGTHKPLPGITVGDIGPKF 230

  Fly   237 GQRASDTRGITFEDVRVPKENVLIGEGAGFKIAM----GTFDK---------TRPPVAAGAVGLA 288
            |....|...:..::.|:|:||:|:      |.|.    ||:.|         |...|.:..||.|
Mouse   231 GYEEMDNGYLKMDNYRIPRENMLM------KYAQVKPDGTYVKPLSNKLTYGTMVFVRSFLVGSA 289

  Fly   289 QRCLDE----ALKYALERK 303
            .:.|.:    |::|:..|:
Mouse   290 AQSLSKACTIAIRYSAVRR 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
McadNP_648149.1 CaiA 35..411 CDD:224871 72/304 (24%)
MCAD 37..414 CDD:173846 72/302 (24%)
Acox1NP_001258827.1 AXO 3..638 CDD:173839 82/344 (24%)
Microbody targeting signal 659..661
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.