DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ank2 and AT1G03670

DIOPT Version :9

Sequence 1:NP_001189070.1 Gene:Ank2 / 38863 FlyBaseID:FBgn0261788 Length:13559 Species:Drosophila melanogaster
Sequence 2:NP_171863.1 Gene:AT1G03670 / 839438 AraportID:AT1G03670 Length:616 Species:Arabidopsis thaliana


Alignment Length:664 Identity:146/664 - (21%)
Similarity:247/664 - (37%) Gaps:214/664 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 DAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAK------ 181
            |:....:.|:..:.||:..|.:|                :.:.....::..||:..|.:      
plant     4 DSKSETVSSSSTSGSLSDPDQWT----------------IFKDKDESEIMNPAILCAVRAGDKVS 52

  Fly   182 -----KDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISP 241
                 .||||....|:||..|                                          |.
plant    53 LLKRINDDVKVTQRLVDNQGN------------------------------------------SI 75

  Fly   242 LHVAAKWGKTNMVSLLLEKGGN-IEAKTRDGLTPLHCAARSGHEQVVDMLL-------ERGAPIS 298
            ||:||..|..::|..::....| ::.....|.|.||.|||:|...:|::|:       ...|.|:
plant    76 LHIAAALGHVHIVEFIISTFPNLLQNVNLMGETTLHVAARAGSLNIVEILVRFITESSSYDAFIA 140

  Fly   299 AKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADA 363
            ||:|||...||.|.:|:||:.|..|:..:..|.                         .|:|.|.
plant   141 AKSKNGDTALHAALKGKHVEVAFCLVSVKHDVS-------------------------FDKNNDE 180

  Fly   364 NARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDAS 428
                                                    .:||::|...|...:|:.:|:..:|
plant   181 ----------------------------------------ASPLYMAVEAGYHELVLKMLESSSS 205

  Fly   429 PDV--PTVRGETPLHLAARANQTDIIRILLR-NGAQVDARAREQQTPLHIASRLGNVDIVMLLLQ 490
            |.:  ....|::.:|.|.:||:.||:.|:|| :...::.|..|.:|.|...:.:|..:.:..:| 
plant   206 PSILASMFSGKSVIHAAMKANRRDILGIVLRQDPGLIELRNEEGRTCLSYGASMGCYEGIRYIL- 269

  Fly   491 HGAQVDATTKDM-YTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLL 554
              |:.|.....: |.|        .|:                  ||||:|:.||.||:::.:..
plant   270 --AEFDKAASSLCYVA--------DDD------------------GFTPIHMAAKEGHVRIIKEF 306

  Fly   555 LQKEAD----VDAQGKNGVTPLHVACHYNNQQVA--LLLLEKG-ASPHATAKNGHTPLHIAARKN 612
            |:...|    ::.|.:|   ..|||......:|.  ||.|::| ...:....||:||||:|. |:
plant   307 LKHCPDSRELLNNQCQN---IFHVAAIAGKSKVVKYLLKLDEGKRMMNEQDINGNTPLHLAT-KH 367

  Fly   613 QMDIATTLLEY--GALANAESKAGFTPLHLSS--QEGHAEISNLLIEHKAAVNHPAKNG--LTPM 671
            :..|...:|.:  |....|.:..|||.|.::.  ::.:|.:....:...|.|:..|.:|  |.|:
plant   368 RYPIVVNMLTWNDGINLRALNNEGFTALDIAETMKDNNAYVLYKRLIWMALVSAGAPHGPNLIPL 432

  Fly   672 HLCAQ--------EDNVNVAEILEKNGANIDMAT----KAGYTPLHVASHFGQANMVR------F 718
            .:...        :|:||...:.....|.:..|.    ..||  :..|.|.|.|.:|.      |
plant   433 TVSQSSKQSPERYKDSVNTLMVTATLVATVTFAAGLTLPGGY--MSSAPHLGMAALVNKLNFKVF 495

  Fly   719 LLQNGANVDAATSI 732
            ||.|  |:...||:
plant   496 LLLN--NIAMCTSV 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ank2NP_001189070.1 ANK repeat 10..41 CDD:293786
Ank_4 11..64 CDD:290365
ANK 38..163 CDD:238125 6/39 (15%)
ANK repeat 43..74 CDD:293786
Ank_2 48..135 CDD:289560 2/11 (18%)
ANK repeat 76..107 CDD:293786
ANK repeat 109..134 CDD:293786 2/10 (20%)
Ank_4 110..163 CDD:290365 6/39 (15%)
Ank_4 172..225 CDD:290365 11/63 (17%)
ANK repeat 175..202 CDD:293786 10/37 (27%)
ANK 199..324 CDD:238125 32/132 (24%)
ANK repeat 204..235 CDD:293786 0/30 (0%)
Ank_2 209..300 CDD:289560 20/98 (20%)
ANK repeat 237..268 CDD:293786 8/31 (26%)
ANK 266..390 CDD:238125 29/130 (22%)
ANK repeat 270..300 CDD:293786 12/36 (33%)
ANK repeat 303..367 CDD:293786 14/63 (22%)
Ank_2 308..399 CDD:289560 12/90 (13%)
ANK 364..489 CDD:238125 23/127 (18%)
ANK repeat 369..400 CDD:293786 0/30 (0%)
ANK repeat 402..433 CDD:293786 8/32 (25%)
Ank_4 403..456 CDD:290365 16/54 (30%)
ANK repeat 435..466 CDD:293786 10/31 (32%)
Ank_2 440..530 CDD:289560 20/91 (22%)
ANK 463..588 CDD:238125 30/131 (23%)
ANK repeat 468..497 CDD:293786 6/28 (21%)
ANK repeat 501..530 CDD:293786 3/29 (10%)
Ank_2 506..597 CDD:289560 22/97 (23%)
ANK 529..654 CDD:238125 38/135 (28%)
ANK repeat 535..565 CDD:293786 11/33 (33%)
ANK repeat 567..598 CDD:293786 9/33 (27%)
Ank_2 572..661 CDD:289560 26/95 (27%)
ANK repeat 600..630 CDD:293786 11/31 (35%)
ANK repeat 633..662 CDD:293786 7/30 (23%)
ANK 661..785 CDD:238125 23/92 (25%)
ANK repeat 666..697 CDD:293786 7/40 (18%)
Ank_2 672..762 CDD:289560 19/79 (24%)
ANK repeat 699..730 CDD:293786 12/36 (33%)
ANK repeat 732..762 CDD:293786 0/1 (0%)
ZU5 927..1030 CDD:128514
Death_ank 1417..1497 CDD:260029
ER-remodelling 11936..>12013 CDD:258892
AT1G03670NP_171863.1 ANK repeat 40..69 CDD:293786 7/28 (25%)
ANK repeat 72..103 CDD:293786 9/72 (13%)
Ank_2 76..172 CDD:372319 32/95 (34%)
ANK repeat 105..143 CDD:293786 13/37 (35%)
ANK repeat 145..173 CDD:293786 10/27 (37%)
ANKYR <214..364 CDD:223738 48/181 (27%)
ANK repeat 214..246 CDD:293786 10/31 (32%)
ANK repeat 248..284 CDD:293786 9/46 (20%)
ANK repeat 286..318 CDD:293786 11/49 (22%)
Ank_2 291..376 CDD:372319 26/88 (30%)
ANK repeat 320..354 CDD:293786 10/36 (28%)
PGG 443..553 CDD:372845 19/69 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1011028at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8400
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.