| Sequence 1: | NP_001189070.1 | Gene: | Ank2 / 38863 | FlyBaseID: | FBgn0261788 | Length: | 13559 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_180450.2 | Gene: | XBAT31 / 817433 | AraportID: | AT2G28840 | Length: | 456 | Species: | Arabidopsis thaliana |
| Alignment Length: | 264 | Identity: | 81/264 - (30%) |
|---|---|---|---|
| Similarity: | 109/264 - (41%) | Gaps: | 73/264 - (27%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 236 KHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPI-SA 299
Fly 300 KTKNGLAPLHMAAQGEHVDAARILL--YHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNAD 362
Fly 363 ANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDA 427
Fly 428 SPDVPTVRGETPLHLAARANQTDIIRILLRNGA---QVDARAREQQTPLHIASRLGNVDIVMLLL 489
Fly 490 QHGA 493 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Ank2 | NP_001189070.1 | ANK repeat | 10..41 | CDD:293786 | |
| Ank_4 | 11..64 | CDD:290365 | |||
| ANK | 38..163 | CDD:238125 | |||
| ANK repeat | 43..74 | CDD:293786 | |||
| Ank_2 | 48..135 | CDD:289560 | |||
| ANK repeat | 76..107 | CDD:293786 | |||
| ANK repeat | 109..134 | CDD:293786 | |||
| Ank_4 | 110..163 | CDD:290365 | |||
| Ank_4 | 172..225 | CDD:290365 | |||
| ANK repeat | 175..202 | CDD:293786 | |||
| ANK | 199..324 | CDD:238125 | 32/88 (36%) | ||
| ANK repeat | 204..235 | CDD:293786 | |||
| Ank_2 | 209..300 | CDD:289560 | 26/64 (41%) | ||
| ANK repeat | 237..268 | CDD:293786 | 13/30 (43%) | ||
| ANK | 266..390 | CDD:238125 | 36/126 (29%) | ||
| ANK repeat | 270..300 | CDD:293786 | 12/30 (40%) | ||
| ANK repeat | 303..367 | CDD:293786 | 14/65 (22%) | ||
| Ank_2 | 308..399 | CDD:289560 | 25/92 (27%) | ||
| ANK | 364..489 | CDD:238125 | 39/127 (31%) | ||
| ANK repeat | 369..400 | CDD:293786 | 12/30 (40%) | ||
| ANK repeat | 402..433 | CDD:293786 | 3/30 (10%) | ||
| Ank_4 | 403..456 | CDD:290365 | 14/52 (27%) | ||
| ANK repeat | 435..466 | CDD:293786 | 18/33 (55%) | ||
| Ank_2 | 440..530 | CDD:289560 | 21/57 (37%) | ||
| ANK | 463..588 | CDD:238125 | 8/31 (26%) | ||
| ANK repeat | 468..497 | CDD:293786 | 5/26 (19%) | ||
| ANK repeat | 501..530 | CDD:293786 | |||
| Ank_2 | 506..597 | CDD:289560 | |||
| ANK | 529..654 | CDD:238125 | |||
| ANK repeat | 535..565 | CDD:293786 | |||
| ANK repeat | 567..598 | CDD:293786 | |||
| Ank_2 | 572..661 | CDD:289560 | |||
| ANK repeat | 600..630 | CDD:293786 | |||
| ANK repeat | 633..662 | CDD:293786 | |||
| ANK | 661..785 | CDD:238125 | |||
| ANK repeat | 666..697 | CDD:293786 | |||
| Ank_2 | 672..762 | CDD:289560 | |||
| ANK repeat | 699..730 | CDD:293786 | |||
| ANK repeat | 732..762 | CDD:293786 | |||
| ZU5 | 927..1030 | CDD:128514 | |||
| Death_ank | 1417..1497 | CDD:260029 | |||
| ER-remodelling | 11936..>12013 | CDD:258892 | |||
| XBAT31 | NP_180450.2 | ANK repeat | 44..76 | CDD:293786 | 13/31 (42%) |
| Ank_2 | 50..134 | CDD:372319 | 31/83 (37%) | ||
| ANK repeat | 78..109 | CDD:293786 | 12/30 (40%) | ||
| ANK repeat | 112..155 | CDD:293786 | 14/65 (22%) | ||
| Ank_2 | 117..225 | CDD:372319 | 46/159 (29%) | ||
| ANK repeat | 157..186 | CDD:293786 | 11/28 (39%) | ||
| ANK repeat | 194..219 | CDD:293786 | 14/30 (47%) | ||
| RING-HC_malin | 318..368 | CDD:319430 | |||
| RING-HC finger (C3HC4-type) | 319..367 | CDD:319430 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG4177 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 1 | 1.000 | - | - | otm3248 | |
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.900 | |||||