DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ank2 and AT1G34046

DIOPT Version :10

Sequence 1:NP_001189070.1 Gene:Ank2 / 38863 FlyBaseID:FBgn0261788 Length:13559 Species:Drosophila melanogaster
Sequence 2:NP_001154392.1 Gene:AT1G34046 / 7922353 AraportID:AT1G34046 Length:97 Species:Arabidopsis thaliana


Alignment Length:96 Identity:29/96 - (30%)
Similarity:41/96 - (42%) Gaps:16/96 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   408 HVAAFMGCMNIVIYLLQ--HDASP---DVPTVRGETPLHLAARANQTDIIRILL----RNGA--Q 461
            |:..:..||...|.:|.  .|.:|   |:.|:..||..|||..........|:.    ||..  |
plant     4 HLCIWRPCMKCSIPILNDFSDKAPRYFDILTLGKETVFHLAVEHKNIPTFYIVAESPDRNNLLHQ 68

  Fly   462 VDARAREQQTPLHIA--SRLGNVDIVMLLLQ 490
            ||   |...|.||||  |...:|.:.:.::|
plant    69 VD---RYDNTVLHIAVMSSCYSVILYITMIQ 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ank2NP_001189070.1 ANKYR 10..308 CDD:440430
ANK repeat 10..41 CDD:293786
ANK repeat 43..74 CDD:293786
ANK repeat 76..107 CDD:293786
ANK repeat 109..134 CDD:293786
ANK repeat 175..202 CDD:293786
ANKYR 190..473 CDD:440430 22/75 (29%)
ANK repeat 204..235 CDD:293786
ANK repeat 237..268 CDD:293786
ANK repeat 270..300 CDD:293786
ANK repeat 303..367 CDD:293786
ANK repeat 369..400 CDD:293786
ANKYR 383..671 CDD:440430 29/96 (30%)
ANK repeat 402..433 CDD:293786 8/29 (28%)
ANK repeat 435..466 CDD:293786 11/36 (31%)
ANK repeat 468..497 CDD:293786 8/25 (32%)
ANK repeat 501..530 CDD:293786
ANK repeat 535..565 CDD:293786
ANK repeat 567..598 CDD:293786
PHA03100 599..>773 CDD:476869
ANK repeat 600..630 CDD:293786
ANK repeat 633..662 CDD:293786
ANK repeat 666..697 CDD:293786
ANK repeat 699..730 CDD:293786
ANK repeat 732..762 CDD:293786
ZU5 930..1027 CDD:459941
UPA_2 1253..1384 CDD:375346
Death_ank 1417..1497 CDD:260029
PTZ00121 <1443..2235 CDD:173412
PTZ00449 <3292..3611 CDD:185628
PTZ00449 <4400..4857 CDD:185628
PTZ00449 <4908..5267 CDD:185628
PTZ00108 <5179..5374 CDD:240271
PTZ00108 <6034..6230 CDD:240271
PTZ00449 <6620..6979 CDD:185628
PTZ00108 <7119..7314 CDD:240271
PTZ00108 <7347..7544 CDD:240271
PTZ00108 <7651..7848 CDD:240271
PTZ00449 <7804..8119 CDD:185628
PTZ00108 <8183..8381 CDD:240271
PTZ00449 <8430..8745 CDD:185628
PTZ00449 <8784..9125 CDD:185628
PTZ00449 <9028..9353 CDD:185628
PHA03307 9225..>9575 CDD:223039
PHA03307 9903..>10259 CDD:223039
PTZ00108 <10177..10451 CDD:240271
AT1G34046NP_001154392.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.