DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ank2 and Ankrd65

DIOPT Version :9

Sequence 1:NP_001189070.1 Gene:Ank2 / 38863 FlyBaseID:FBgn0261788 Length:13559 Species:Drosophila melanogaster
Sequence 2:NP_001102897.1 Gene:Ankrd65 / 680734 RGDID:1588232 Length:365 Species:Rattus norvegicus


Alignment Length:397 Identity:125/397 - (31%)
Similarity:174/397 - (43%) Gaps:74/397 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 SPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNG 304
            |.|..|..||..::|..||.:|.::|.:...|.||||.|...||..:|.:||:|||...|....|
  Rat    35 STLFQAVWWGAPSLVMQLLRQGASVEERDHTGRTPLHLAVMRGHAPLVRLLLQRGALAGAVDHTG 99

  Fly   305 LAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALN 369
            ..|||.||            :|                     ||..||                
  Rat   100 RTPLHEAA------------WH---------------------GHSNVA---------------- 115

  Fly   370 GFTPLHIACKKNRLKVVELLLRHGASISA-TTESGLTPLHVAAFMG-CMNIVIYLLQHDASPDVP 432
                             |||||.|||.:| .:::||||||.||.:| .:.:..:....|:.|||.
  Rat   116 -----------------ELLLRRGASAAAPCSQTGLTPLHGAAALGRTLLVTCFTAAPDSVPDVK 163

  Fly   433 TVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDA 497
            .:||.|..|.||...|..::. ||..|..||.     ...|.:::..|:...:.|||..||:|||
  Rat   164 DIRGWTATHWAAACGQLPVLE-LLTAGGSVDL-----DGALLVSAVAGSASALRLLLTLGAKVDA 222

  Fly   498 TTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVD 562
            ......|||.:||..|..:...||:.:||..:...:...:.||..|..|.::..|||:.|..|||
  Rat   223 LDSTGATALGLAAGLGHHQEIEVLLGHGADPNIRDRNNRSALHRAASGGCLRAIQLLVAKGTDVD 287

  Fly   563 AQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALA 627
            |:...|:||||.|....:::|...||::||...|......||||:|.......|...||..||..
  Rat   288 ARDSLGLTPLHYAARGGHREVVSHLLDRGAHVDAAGWLHKTPLHLAVECGHTTILELLLSRGANP 352

  Fly   628 NAESKAG 634
            :..::.|
  Rat   353 SLRTQWG 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ank2NP_001189070.1 ANK repeat 10..41 CDD:293786
Ank_4 11..64 CDD:290365
ANK 38..163 CDD:238125
ANK repeat 43..74 CDD:293786
Ank_2 48..135 CDD:289560
ANK repeat 76..107 CDD:293786
ANK repeat 109..134 CDD:293786
Ank_4 110..163 CDD:290365
Ank_4 172..225 CDD:290365
ANK repeat 175..202 CDD:293786
ANK 199..324 CDD:238125 31/83 (37%)
ANK repeat 204..235 CDD:293786
Ank_2 209..300 CDD:289560 24/59 (41%)
ANK repeat 237..268 CDD:293786 10/27 (37%)
ANK 266..390 CDD:238125 28/123 (23%)
ANK repeat 270..300 CDD:293786 14/29 (48%)
ANK repeat 303..367 CDD:293786 11/63 (17%)
Ank_2 308..399 CDD:289560 18/91 (20%)
ANK 364..489 CDD:238125 37/126 (29%)
ANK repeat 369..400 CDD:293786 9/31 (29%)
ANK repeat 402..433 CDD:293786 13/31 (42%)
Ank_4 403..456 CDD:290365 20/53 (38%)
ANK repeat 435..466 CDD:293786 12/30 (40%)
Ank_2 440..530 CDD:289560 29/89 (33%)
ANK 463..588 CDD:238125 40/124 (32%)
ANK repeat 468..497 CDD:293786 8/28 (29%)
ANK repeat 501..530 CDD:293786 10/28 (36%)
Ank_2 506..597 CDD:289560 31/90 (34%)
ANK 529..654 CDD:238125 35/106 (33%)
ANK repeat 535..565 CDD:293786 12/29 (41%)
ANK repeat 567..598 CDD:293786 12/30 (40%)
Ank_2 572..661 CDD:289560 20/63 (32%)
ANK repeat 600..630 CDD:293786 10/29 (34%)
ANK repeat 633..662 CDD:293786 1/2 (50%)
ANK 661..785 CDD:238125
ANK repeat 666..697 CDD:293786
Ank_2 672..762 CDD:289560
ANK repeat 699..730 CDD:293786
ANK repeat 732..762 CDD:293786
ZU5 927..1030 CDD:128514
Death_ank 1417..1497 CDD:260029
ER-remodelling 11936..>12013 CDD:258892
Ankrd65NP_001102897.1 ANK 33..149 CDD:238125 54/179 (30%)
ANK repeat 33..63 CDD:293786 10/27 (37%)
Ank_2 37..123 CDD:289560 40/151 (26%)
ANK repeat 65..96 CDD:293786 15/30 (50%)
ANK repeat 98..123 CDD:293786 16/90 (18%)
ANK repeat 197..224 CDD:293786 10/26 (38%)
Ank_2 198..290 CDD:289560 32/91 (35%)
ANK 221..346 CDD:238125 42/124 (34%)
ANK repeat 227..257 CDD:293786 10/29 (34%)
ANK repeat 259..290 CDD:293786 12/30 (40%)
Ank_2 264..355 CDD:289560 34/90 (38%)
ANK repeat 292..323 CDD:293786 12/30 (40%)
ANK repeat 325..355 CDD:293786 10/29 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4177
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.