DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ank2 and IQANK1

DIOPT Version :10

Sequence 1:NP_001189070.1 Gene:Ank2 / 38863 FlyBaseID:FBgn0261788 Length:13559 Species:Drosophila melanogaster
Sequence 2:NP_001368803.1 Gene:IQANK1 / 642574 HGNCID:49576 Length:560 Species:Homo sapiens


Alignment Length:214 Identity:58/214 - (27%)
Similarity:85/214 - (39%) Gaps:46/214 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ENGAQGDGNTSFLRAAR---------AGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIH- 58
            |..||.:......|..|         .|.:..||:.::                .|.:::|..| 
Human   122 EEAAQRERREELQRRRRLLDAAFDGDVGEIRAVLKEVE----------------QLLTREGVGHD 170

  Fly    59 ---VVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQE 120
               ....|.||.|:.:.....|||.|..|:..||...::|..|..||.|.:...|.||||.||..
Human   171 EAGEARRLQRRVALAECEDSYGNTPLSEAAAGGQPLAIQLRAELGASPNSKGAFGPTPLYRAAFG 235

  Fly   121 NHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVL--------------LESDTRGKV 171
            .|.|.|.:||..||:..:..|||.||..||   ..|.||:||              :|::.:.:.
Human   236 GHLAAVEVLLKLGADPRVYAEDGSTPERVA---SLDTVVSVLRSWDLSLTEAMLQNMEAEQQRRA 297

  Fly   172 RLPALHIAAKKDDVKAATL 190
            :....|..|:.:...:.||
Human   298 QEAQRHKEAEAERCGSMTL 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ank2NP_001189070.1 ANKYR 10..308 CDD:440430 55/208 (26%)
ANK repeat 10..41 CDD:293786 5/39 (13%)
ANK repeat 43..74 CDD:293786 7/34 (21%)
ANK repeat 76..107 CDD:293786 12/30 (40%)
ANK repeat 109..134 CDD:293786 12/24 (50%)
ANK repeat 175..202 CDD:293786 4/16 (25%)
ANKYR 190..473 CDD:440430 1/1 (100%)
ANK repeat 204..235 CDD:293786
ANK repeat 237..268 CDD:293786
ANK repeat 270..300 CDD:293786
ANK repeat 303..367 CDD:293786
ANK repeat 369..400 CDD:293786
ANKYR 383..671 CDD:440430
ANK repeat 402..433 CDD:293786
ANK repeat 435..466 CDD:293786
ANK repeat 468..497 CDD:293786
ANK repeat 501..530 CDD:293786
ANK repeat 535..565 CDD:293786
ANK repeat 567..598 CDD:293786
PHA03100 599..>773 CDD:476869
ANK repeat 600..630 CDD:293786
ANK repeat 633..662 CDD:293786
ANK repeat 666..697 CDD:293786
ANK repeat 699..730 CDD:293786
ANK repeat 732..762 CDD:293786
ZU5 930..1027 CDD:459941
UPA_2 1253..1384 CDD:375346
Death_ank 1417..1497 CDD:260029
PTZ00121 <1443..2235 CDD:173412
PTZ00449 <3292..3611 CDD:185628
PTZ00449 <4400..4857 CDD:185628
PTZ00449 <4908..5267 CDD:185628
PTZ00108 <5179..5374 CDD:240271
PTZ00108 <6034..6230 CDD:240271
PTZ00449 <6620..6979 CDD:185628
PTZ00108 <7119..7314 CDD:240271
PTZ00108 <7347..7544 CDD:240271
PTZ00108 <7651..7848 CDD:240271
PTZ00449 <7804..8119 CDD:185628
PTZ00108 <8183..8381 CDD:240271
PTZ00449 <8430..8745 CDD:185628
PTZ00449 <8784..9125 CDD:185628
PTZ00449 <9028..9353 CDD:185628
PHA03307 9225..>9575 CDD:223039
PHA03307 9903..>10259 CDD:223039
PTZ00108 <10177..10451 CDD:240271
IQANK1NP_001368803.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..72
ANKYR <189..>265 CDD:440430 31/75 (41%)
ANK 1. /evidence=ECO:0000255 191..223 12/31 (39%)
ANK repeat 191..222 CDD:293786 12/30 (40%)
ANK repeat 224..255 CDD:293786 14/30 (47%)
ANK 2. /evidence=ECO:0000255 224..253 14/28 (50%)
AAA_9 430..>549 CDD:463702
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.