DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ank2 and HACE1

DIOPT Version :9

Sequence 1:NP_001189070.1 Gene:Ank2 / 38863 FlyBaseID:FBgn0261788 Length:13559 Species:Drosophila melanogaster
Sequence 2:NP_065822.2 Gene:HACE1 / 57531 HGNCID:21033 Length:909 Species:Homo sapiens


Alignment Length:528 Identity:122/528 - (23%)
Similarity:196/528 - (37%) Gaps:144/528 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 KAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYS-AKHNISPLHVAAKWG 249
            :|.|:.|..|:.   |:.....|:.:|..:  ::::.||.....||||: .:...|.||:||..|
Human    17 RARTVELPEDNE---TAVYTLMPMVMADQH--RSVSELLSNSKFDVNYAFGRVKRSLLHIAANCG 76

  Fly   250 KTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQG 314
            ....:.|||:||.|...:...|.||||.|||:|.::.:..|||..|.::.....||..:|..|..
Human    77 SVECLVLLLKKGANPNYQDISGCTPLHLAARNGQKKCMSKLLEYSADVNICNNEGLTAIHWLAVN 141

  Fly   315 EHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACK 379
            ...:....|:.|.:.||.......||||||...||....:.|||..||.|...::|.|||:.||.
Human   142 GRTELLHDLVQHVSDVDVEDAMGQTALHVACQNGHKTTVQCLLDSGADINRPNVSGATPLYFACS 206

  Fly   380 KNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAA 444
            ..:....::||..||.                         ||         |...|.|||.|..
Human   207 HGQRDTAQILLLRGAK-------------------------YL---------PDKNGVTPLDLCV 237

  Fly   445 RANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDI----VMLLLQHGAQVDATTKDMYTA 505
            :....:...:|      :....|..||.:.:..   |.|:    :..:|:|.:|           
Human   238 QGGYGETCEVL------IQYHPRLFQTIIQMTQ---NEDLRENMLRQVLEHLSQ----------- 282

  Fly   506 LHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVT 570
                  :.:.:...:|.   :..:.||..|...|.|::.|                |||.|:.:.
Human   283 ------QSESQYLKILT---SLAEVATTNGHKLLSLSSNY----------------DAQMKSLLR 322

  Fly   571 PLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAG- 634
            .:.:.||         :...|.|   :..||                   ::.|...|...::. 
Human   323 IVRMFCH---------VFRIGPS---SPSNG-------------------IDMGYNGNKTPRSQV 356

  Fly   635 FTPLHL---SSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEI-LEKNGANIDM 695
            |.||.|   |..|....|:..|:::|                   .|:..:..| |::.|.:.|.
Human   357 FKPLELLWHSLDEWLVLIATELMKNK-------------------RDSTEITSILLKQKGQDQDA 402

  Fly   696 ATKAGYTP 703
            |:...:.|
Human   403 ASIPPFEP 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ank2NP_001189070.1 ANK repeat 10..41 CDD:293786
Ank_4 11..64 CDD:290365
ANK 38..163 CDD:238125
ANK repeat 43..74 CDD:293786
Ank_2 48..135 CDD:289560
ANK repeat 76..107 CDD:293786
ANK repeat 109..134 CDD:293786
Ank_4 110..163 CDD:290365
Ank_4 172..225 CDD:290365 8/38 (21%)
ANK repeat 175..202 CDD:293786 4/15 (27%)
ANK 199..324 CDD:238125 38/125 (30%)
ANK repeat 204..235 CDD:293786 8/31 (26%)
Ank_2 209..300 CDD:289560 32/91 (35%)
ANK repeat 237..268 CDD:293786 12/30 (40%)
ANK 266..390 CDD:238125 41/123 (33%)
ANK repeat 270..300 CDD:293786 13/29 (45%)
ANK repeat 303..367 CDD:293786 22/63 (35%)
Ank_2 308..399 CDD:289560 30/90 (33%)
ANK 364..489 CDD:238125 25/128 (20%)
ANK repeat 369..400 CDD:293786 10/30 (33%)
ANK repeat 402..433 CDD:293786 2/30 (7%)
Ank_4 403..456 CDD:290365 8/52 (15%)
ANK repeat 435..466 CDD:293786 6/30 (20%)
Ank_2 440..530 CDD:289560 12/93 (13%)
ANK 463..588 CDD:238125 21/128 (16%)
ANK repeat 468..497 CDD:293786 7/32 (22%)
ANK repeat 501..530 CDD:293786 1/28 (4%)
Ank_2 506..597 CDD:289560 15/90 (17%)
ANK 529..654 CDD:238125 25/128 (20%)
ANK repeat 535..565 CDD:293786 6/29 (21%)
ANK repeat 567..598 CDD:293786 4/30 (13%)
Ank_2 572..661 CDD:289560 17/92 (18%)
ANK repeat 600..630 CDD:293786 4/29 (14%)
ANK repeat 633..662 CDD:293786 9/32 (28%)
ANK 661..785 CDD:238125 7/44 (16%)
ANK repeat 666..697 CDD:293786 5/31 (16%)
Ank_2 672..762 CDD:289560 7/33 (21%)
ANK repeat 699..730 CDD:293786 1/5 (20%)
ANK repeat 732..762 CDD:293786
ZU5 927..1030 CDD:128514
Death_ank 1417..1497 CDD:260029
ER-remodelling 11936..>12013 CDD:258892
HACE1NP_065822.2 Ank_2 <27..>283 CDD:330894 83/320 (26%)
ANK 1 64..93 12/28 (43%)
ANK repeat 66..95 CDD:293786 12/28 (43%)
ANK 92..217 CDD:238125 41/124 (33%)
ANK repeat 97..128 CDD:293786 13/30 (43%)
ANK 2 97..126 13/28 (46%)
ANK repeat 130..161 CDD:293786 8/30 (27%)
ANK 3 130..159 7/28 (25%)
ANK repeat 163..194 CDD:293786 14/30 (47%)
ANK 4 163..192 13/28 (46%)
ANK 5 196..226 12/63 (19%)
ANK repeat 196..221 CDD:293786 8/24 (33%)
ANK 6 228..257 7/34 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 398..433 3/13 (23%)
HECTc 554..903 CDD:238033
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4177
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.