DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ank2 and ankdd1a

DIOPT Version :9

Sequence 1:NP_001189070.1 Gene:Ank2 / 38863 FlyBaseID:FBgn0261788 Length:13559 Species:Drosophila melanogaster
Sequence 2:NP_001092718.1 Gene:ankdd1a / 569271 ZFINID:ZDB-GENE-070615-8 Length:489 Species:Danio rerio


Alignment Length:378 Identity:106/378 - (28%)
Similarity:182/378 - (48%) Gaps:27/378 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 HLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTP 113
            |.|:|......:.||:.||..:....|....|||.|:.||.|:.::|||:|:..|:.....|...
Zfish    20 HDAAKRNDTERMQELISRGVDIKVKNKMDRKALHWAAGAGSEQALRLLLDHDMDVDDMDSFGMNA 84

  Fly   114 LYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHI 178
            |.:||...|..::::|:|.||..:...::|...|..|.|:||..::..::|              
Zfish    85 LLLAAWFGHLTILKILVSTGAKLTTENKNGLNLLHCAAQRGHITILEYIME-------------- 135

  Fly   179 AAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLH 243
                 |::...|        :....||.|..|:|:.:|:..:...||..|...|...||..:.||
Zfish   136 -----DLENVQL--------NKVENSGKTAFHLAAEHGHLEVVEFLIGMGCAHNLKDKHGNTALH 187

  Fly   244 VAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPL 308
            :|||.|.::::..::|.|.||:.:..||:|.||.|:..||.:.:.:|||.|..::..|.:....|
Zfish   188 LAAKQGHSDVLQKIMETGENIDERNIDGMTALHLASEGGHYECIRLLLEAGCNVNELTDSKRTAL 252

  Fly   309 HMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTP 373
            |:.||.......|:|:.....:|.|...:::|||:|.......:.|.|::...|.:.......|.
Zfish   253 HLVAQHASASEVRLLIQAGINLDSVDTQHVSALHLAVLNNSTEIVKDLIEAGCDLDIFDNRLQTA 317

  Fly   374 LHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHD 426
            ||||.:..||.:.|.:|..|.:::...:.|.:.|.|||....:|:|..:::.|
Zfish   318 LHIAAEHGRLNIAETILISGVNLNLLDKQGKSSLDVAARGNHVNVVDMIIKAD 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ank2NP_001189070.1 ANK repeat 10..41 CDD:293786
Ank_4 11..64 CDD:290365 4/14 (29%)
ANK 38..163 CDD:238125 35/113 (31%)
ANK repeat 43..74 CDD:293786 7/24 (29%)
Ank_2 48..135 CDD:289560 28/85 (33%)
ANK repeat 76..107 CDD:293786 12/30 (40%)
ANK repeat 109..134 CDD:293786 7/24 (29%)
Ank_4 110..163 CDD:290365 15/52 (29%)
Ank_4 172..225 CDD:290365 8/52 (15%)
ANK repeat 175..202 CDD:293786 2/26 (8%)
ANK 199..324 CDD:238125 40/124 (32%)
ANK repeat 204..235 CDD:293786 10/30 (33%)
Ank_2 209..300 CDD:289560 31/90 (34%)
ANK repeat 237..268 CDD:293786 11/30 (37%)
ANK 266..390 CDD:238125 36/123 (29%)
ANK repeat 270..300 CDD:293786 12/29 (41%)
ANK repeat 303..367 CDD:293786 15/63 (24%)
Ank_2 308..399 CDD:289560 25/90 (28%)
ANK 364..489 CDD:238125 18/63 (29%)
ANK repeat 369..400 CDD:293786 10/30 (33%)
ANK repeat 402..433 CDD:293786 8/25 (32%)
Ank_4 403..456 CDD:290365 8/24 (33%)
ANK repeat 435..466 CDD:293786
Ank_2 440..530 CDD:289560
ANK 463..588 CDD:238125
ANK repeat 468..497 CDD:293786
ANK repeat 501..530 CDD:293786
Ank_2 506..597 CDD:289560
ANK 529..654 CDD:238125
ANK repeat 535..565 CDD:293786
ANK repeat 567..598 CDD:293786
Ank_2 572..661 CDD:289560
ANK repeat 600..630 CDD:293786
ANK repeat 633..662 CDD:293786
ANK 661..785 CDD:238125
ANK repeat 666..697 CDD:293786
Ank_2 672..762 CDD:289560
ANK repeat 699..730 CDD:293786
ANK repeat 732..762 CDD:293786
ZU5 927..1030 CDD:128514
Death_ank 1417..1497 CDD:260029
ER-remodelling 11936..>12013 CDD:258892
ankdd1aNP_001092718.1 ANK 19..134 CDD:238125 35/113 (31%)
Ank_2 19..111 CDD:289560 29/90 (32%)
ANK repeat 19..45 CDD:293786 7/24 (29%)
ANK repeat 47..78 CDD:293786 12/30 (40%)
ANK 79..202 CDD:238125 36/149 (24%)
ANK repeat 80..111 CDD:293786 9/30 (30%)
Ank_2 85..179 CDD:289560 27/120 (23%)
ANK repeat 113..146 CDD:293786 9/59 (15%)
ANK 143..268 CDD:238125 40/124 (32%)
ANK repeat 148..179 CDD:293786 10/30 (33%)
Ank_2 153..242 CDD:289560 31/88 (35%)
ANK repeat 181..212 CDD:293786 11/30 (37%)
ANK 209..334 CDD:238125 36/124 (29%)
ANK repeat 214..242 CDD:293786 12/27 (44%)
ANK repeat 247..278 CDD:293786 7/30 (23%)
Ank_2 252..344 CDD:289560 25/91 (27%)
ANK repeat 280..311 CDD:293786 7/30 (23%)
ANK repeat 313..344 CDD:293786 10/30 (33%)
DD 402..474 CDD:301326
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.