DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ank2 and PIDD1

DIOPT Version :9

Sequence 1:NP_001189070.1 Gene:Ank2 / 38863 FlyBaseID:FBgn0261788 Length:13559 Species:Drosophila melanogaster
Sequence 2:XP_005253062.1 Gene:PIDD1 / 55367 HGNCID:16491 Length:934 Species:Homo sapiens


Alignment Length:696 Identity:152/696 - (21%)
Similarity:268/696 - (38%) Gaps:173/696 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   898 PKATVDGVYI---ANGSGHDEP-----------PHVGRKLSWKSFLVSFLVDARGGAMR-GCRHS 947
            |...:|..::   .|..|...|           |.:.| |...|.|.||.|..:|.::. .|   
Human   279 PPELLDAPFVRLQGNPLGEASPDAPSSPVAALIPEMPR-LFLTSDLDSFPVTPQGCSVTLAC--- 339

  Fly   948 GVRMIIPSRSTCQPTRVTCRYVKPQRTMHPPQLMEGEALASRVLELGPCSTKF---IGPVVMEVP 1009
            |||:..|:.:|..|..:..|.:.|:..:.|  |...:||.|.||||.|....|   :|..::..|
Human   340 GVRLQFPAGATATPITIRYRLLLPEPGLVP--LGPHDALLSHVLELQPHGVAFQQDVGLWLLFTP 402

  Fly  1010 HFASLRGKEREIIILRSDNGETWREHTIDNSEEIIHDVLQQCFEPEEIAQLEEQAGNHVCRFVTY 1074
            ..|.   :.||::: |:.|..:|.:             |:        ..|||:|...:......
Human   403 PQAR---RCREVVV-RTRNDNSWGD-------------LE--------TYLEEEAPQRLWAHCQV 442

  Fly  1075 DFPQYFAVVSRIRQEVHAIGPEGGMVSSTVVPQVQAVFPQGALTKKIKVGLQ-AQPVDPDLTAKL 1138
            ....:|.||||.......:.|||.::.|:..|.|:.:||.||..:..:|.:| .:....:|.|.|
Human   443 PHFSWFLVVSRPVSNACLVPPEGTLLCSSGHPGVKVIFPPGATEEPRRVSMQVVRMAGRELQALL 507

  Fly  1139 LGRGVAVSPIVTV-EPRRRKFHKAITLSMPAPKAHSQGMINQYSGNTPTLRLLCSITGGPSRAQW 1202
            .....||||::.: :.....|.:.:|:.:|.|..     |...|.:...|.||   ...|..|.|
Human   508 GEPEAAVSPLLCLSQSGPPSFLQPVTVQLPLPSG-----ITGLSLDRSRLHLL---YWAPPAATW 564

  Fly  1203 EDVTG--------------------STPLTFVND----CVSFTTTVSARFWL----MDCRNISDA 1239
            :|:|.                    |.|.:|::.    |.:..|..|.|:||    .:|  :...
Human   565 DDITAQVVLELTHLYARFQVTHFSWSVPPSFLSPPPPVCTALLTPSSPRYWLWYTTKNC--VGGL 627

  Fly  1240 TKMATELYKEVIHVPFIAKFVVFAKKVEPFEAKLRVFCMTDDREDKTLEK-HELYTEVAKSRDVE 1303
            .:.|.|..:  :|   ....:...::.:|.:..|:  |:..::.|.||.: .|.|.....|..||
Human   628 ARKAWERLR--LH---RVNLIALQRRRDPEQVLLQ--CLPRNKVDATLRRLLERYRGPEPSDTVE 685

  Fly  1304 VLEG----------------KPQYIEMAGNL-------------VPVTKSGDQLQVQFK---AFR 1336
            :.||                :|..:|  |.:             |.||.:.|:.....:   :|.
Human   686 MFEGEEFFAAFERGIDVDADRPDCVE--GRICFVFYSHLKNVKEVYVTTTLDREAQAVRGQVSFY 748

  Fly  1337 ENRLPFTVRVKDQ--------HADIVG-RTLFMKEPKVAKGEPPQQPICILNIVLPEAVIPDSTT 1392
            ...:|  |||.::        .||.:. .||.:|.|::...|.|::.   ..:.|....:.|:.|
Human   749 RGAVP--VRVPEEAEAARQRKGADALWMATLPIKLPRLRGSEGPRRG---AGLSLAPLNLGDAET 808

  Fly  1393 AFSDRVTSAYRTSMFSLSKHQNDHYIGDIRIVDLSNLLGKDWIQLAPEIGINGEEIDEIINQNTD 1457
            .|                       :....::.::..||.||..:|..:|::..|:..|.::..|
Human   809 GF-----------------------LTQSNLLSVAGRLGLDWPAVALHLGVSYREVQRIRHEFRD 850

  Fly  1458 SIARQAQSMIRLYKDK----PNYDILSLETALKNIGRDDIMKKCKS 1499
            .:..|.:.|:..:.::    |. .:..|..||:...|.|:.::.::
Human   851 DLDEQIRHMLFSWAERQAGQPG-AVGLLVQALEQSDRQDVAEEVRA 895

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ank2NP_001189070.1 ANK repeat 10..41 CDD:293786
Ank_4 11..64 CDD:290365
ANK 38..163 CDD:238125
ANK repeat 43..74 CDD:293786
Ank_2 48..135 CDD:289560
ANK repeat 76..107 CDD:293786
ANK repeat 109..134 CDD:293786
Ank_4 110..163 CDD:290365
Ank_4 172..225 CDD:290365
ANK repeat 175..202 CDD:293786
ANK 199..324 CDD:238125
ANK repeat 204..235 CDD:293786
Ank_2 209..300 CDD:289560
ANK repeat 237..268 CDD:293786
ANK 266..390 CDD:238125
ANK repeat 270..300 CDD:293786
ANK repeat 303..367 CDD:293786
Ank_2 308..399 CDD:289560
ANK 364..489 CDD:238125
ANK repeat 369..400 CDD:293786
ANK repeat 402..433 CDD:293786
Ank_4 403..456 CDD:290365
ANK repeat 435..466 CDD:293786
Ank_2 440..530 CDD:289560
ANK 463..588 CDD:238125
ANK repeat 468..497 CDD:293786
ANK repeat 501..530 CDD:293786
Ank_2 506..597 CDD:289560
ANK 529..654 CDD:238125
ANK repeat 535..565 CDD:293786
ANK repeat 567..598 CDD:293786
Ank_2 572..661 CDD:289560
ANK repeat 600..630 CDD:293786
ANK repeat 633..662 CDD:293786
ANK 661..785 CDD:238125
ANK repeat 666..697 CDD:293786
Ank_2 672..762 CDD:289560
ANK repeat 699..730 CDD:293786
ANK repeat 732..762 CDD:293786
ZU5 927..1030 CDD:128514 33/106 (31%)
Death_ank 1417..1497 CDD:260029 17/83 (20%)
ER-remodelling 11936..>12013 CDD:258892
PIDD1XP_005253062.1 leucine-rich repeat 39..63 CDD:275380
leucine-rich repeat 64..91 CDD:275380
LRR_RI <117..>279 CDD:238064 152/696 (22%)
LRR_8 126..183 CDD:290566
leucine-rich repeat 127..152 CDD:275380
leucine-rich repeat 153..172 CDD:275380
leucine-rich repeat 173..195 CDD:275380
LRR_8 194..252 CDD:290566
leucine-rich repeat 196..218 CDD:275380
leucine-rich repeat 219..241 CDD:275380
LRR_8 240..295 CDD:290566 3/15 (20%)
leucine-rich repeat 242..264 CDD:275380
leucine-rich repeat 265..286 CDD:275380 2/6 (33%)
ZU5 325..398 CDD:295340 25/77 (32%)
Peptidase_S68 421..453 CDD:287439 9/52 (17%)
ZU5 465..537 CDD:295340 19/71 (27%)
Death_PIDD 812..897 CDD:260049 17/85 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4177
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.