DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ank2 and Asb4

DIOPT Version :9

Sequence 1:NP_001189070.1 Gene:Ank2 / 38863 FlyBaseID:FBgn0261788 Length:13559 Species:Drosophila melanogaster
Sequence 2:NP_001019489.1 Gene:Asb4 / 500017 RGDID:1563114 Length:426 Species:Rattus norvegicus


Alignment Length:296 Identity:73/296 - (24%)
Similarity:116/296 - (39%) Gaps:104/296 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   515 DEVAAVLIENGAALD------------AATKKGF------------TPLHLTAKYGHIKVAQLLL 555
            :::.|:|||....:|            |:.|:|:            |.|||:...||::...:||
  Rat    31 EKLKAILIERQIDVDTVFEVEDENMILASYKQGYWLPSYKLKSSWATGLHLSVLLGHVECLMVLL 95

  Fly   556 QKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTL 620
            ...|.::.: .||.|||||||...|.:...:|.::||..:..:.:|||.|               
  Rat    96 DHNATINCR-PNGKTPLHVACEIANLECVKILCDRGAKLNCYSLSGHTAL--------------- 144

  Fly   621 LEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEI 685
                                                               |.|....::..|:.
  Rat   145 ---------------------------------------------------HFCTTPSSIVCAKQ 158

  Fly   686 LEKNGANIDMAT--KAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPL----------- 737
            |...|||::|.|  :...||||.|:|||.:.:|.|.::|||.||:..:...|||           
  Rat   159 LVSRGANVNMKTNNQDEETPLHTAAHFGLSELVAFYVENGAIVDSMNAHMETPLAIATYWALRFK 223

  Fly   738 HQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIA 773
            .|...:.|..|..:||::.|..||:..:.::|||.|
  Rat   224 EQEYSREHHLICRMLLDNNAEVNARDDDFKSPLHKA 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ank2NP_001189070.1 ANK repeat 10..41 CDD:293786
Ank_4 11..64 CDD:290365
ANK 38..163 CDD:238125
ANK repeat 43..74 CDD:293786
Ank_2 48..135 CDD:289560
ANK repeat 76..107 CDD:293786
ANK repeat 109..134 CDD:293786
Ank_4 110..163 CDD:290365
Ank_4 172..225 CDD:290365
ANK repeat 175..202 CDD:293786
ANK 199..324 CDD:238125
ANK repeat 204..235 CDD:293786
Ank_2 209..300 CDD:289560
ANK repeat 237..268 CDD:293786
ANK 266..390 CDD:238125
ANK repeat 270..300 CDD:293786
ANK repeat 303..367 CDD:293786
Ank_2 308..399 CDD:289560
ANK 364..489 CDD:238125
ANK repeat 369..400 CDD:293786
ANK repeat 402..433 CDD:293786
Ank_4 403..456 CDD:290365
ANK repeat 435..466 CDD:293786
Ank_2 440..530 CDD:289560 5/26 (19%)
ANK 463..588 CDD:238125 27/96 (28%)
ANK repeat 468..497 CDD:293786
ANK repeat 501..530 CDD:293786 5/26 (19%)
Ank_2 506..597 CDD:289560 30/105 (29%)
ANK 529..654 CDD:238125 30/148 (20%)
ANK repeat 535..565 CDD:293786 10/41 (24%)
ANK repeat 567..598 CDD:293786 13/30 (43%)
Ank_2 572..661 CDD:289560 13/88 (15%)
ANK repeat 600..630 CDD:293786 4/29 (14%)
ANK repeat 633..662 CDD:293786 0/28 (0%)
ANK 661..785 CDD:238125 39/126 (31%)
ANK repeat 666..697 CDD:293786 8/30 (27%)
Ank_2 672..762 CDD:289560 34/102 (33%)
ANK repeat 699..730 CDD:293786 15/30 (50%)
ANK repeat 732..762 CDD:293786 10/40 (25%)
ZU5 927..1030 CDD:128514
Death_ank 1417..1497 CDD:260029
ER-remodelling 11936..>12013 CDD:258892
Asb4NP_001019489.1 ANK 77..191 CDD:238125 43/180 (24%)
ANK repeat 77..104 CDD:293786 9/26 (35%)
Ank_2 79..169 CDD:289560 32/156 (21%)
ANK repeat 106..137 CDD:293786 13/30 (43%)
ANK repeat 139..169 CDD:293786 11/95 (12%)
ANK 172..294 CDD:238125 30/88 (34%)
ANK repeat 172..205 CDD:293786 15/32 (47%)
Ank_2 179..282 CDD:289560 28/81 (35%)
ANK repeat 209..249 CDD:293786 11/39 (28%)
ANK repeat 251..282 CDD:293786 4/9 (44%)
SOCS_ASB4_ASB18 379..426 CDD:239693
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.