DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Ank2 and SOWAHD

DIOPT Version :9

Sequence 1:	NP_001189070.1	Gene:	Ank2 / 38863	FlyBaseID:	FBgn0261788	Length:	13559	Species:	Drosophila melanogaster
Sequence 2:	NP_001099046.1	Gene:	SOWAHD / 347454	HGNCID:	32960	Length:	315	Species:	Homo sapiens

Alignment Length:	151	Identity:	48/151 - (31%)
Similarity:	67/151 - (44%)	Gaps:	25/151 - (16%)

- Green bases have known domain annotations that are detailed below.

  Fly   508 IAAKEGQDEVAAVLIENGAAL----DAATKKGFTPLHLTAKYGH----IKVAQLLLQK--EADVD 562
            :||.||:.||...|:|....|    |..|  |::.||..||:|.    |.|....|::  ..||.
Human   119 LAAAEGRYEVLRELLEAEPELLLRGDPIT--GYSVLHWLAKHGRHEELILVHDFALRRGLRLDVS 181

  Fly   563 AQGKNGVTPLHVACHYNNQQVALLLL-EKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGAL 626
            |.|..|:||||:|....:..|..:|: ..||.......:||...|..    :.|....|.|   |
Human   182 APGSGGLTPLHLAALQGHDMVIKVLVGALGADATRRDHSGHRACHYL----RPDAPWRLRE---L 239

  Fly   627 ANA-----ESKAGFTPLHLSS 642
            :.|     ||.:|.|.|:.:|
Human   240 SGAEEWEMESGSGCTNLNNNS 260

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Ank2	NP_001189070.1	ANK repeat	10..41	CDD:293786
		Ank_4	11..64	CDD:290365
		ANK	38..163	CDD:238125
		ANK repeat	43..74	CDD:293786
		Ank_2	48..135	CDD:289560
		ANK repeat	76..107	CDD:293786
		ANK repeat	109..134	CDD:293786
		Ank_4	110..163	CDD:290365
		Ank_4	172..225	CDD:290365
		ANK repeat	175..202	CDD:293786
		ANK	199..324	CDD:238125
		ANK repeat	204..235	CDD:293786
		Ank_2	209..300	CDD:289560
		ANK repeat	237..268	CDD:293786
		ANK	266..390	CDD:238125
		ANK repeat	270..300	CDD:293786
		ANK repeat	303..367	CDD:293786
		Ank_2	308..399	CDD:289560
		ANK	364..489	CDD:238125
		ANK repeat	369..400	CDD:293786
		ANK repeat	402..433	CDD:293786
		Ank_4	403..456	CDD:290365
		ANK repeat	435..466	CDD:293786
		Ank_2	440..530	CDD:289560	9/25 (36%)
		ANK	463..588	CDD:238125	31/89 (35%)
		ANK repeat	468..497	CDD:293786
		ANK repeat	501..530	CDD:293786	9/25 (36%)
		Ank_2	506..597	CDD:289560	34/99 (34%)
		ANK	529..654	CDD:238125	39/126 (31%)
		ANK repeat	535..565	CDD:293786	12/35 (34%)
		ANK repeat	567..598	CDD:293786	10/31 (32%)
		Ank_2	572..661	CDD:289560	21/77 (27%)
		ANK repeat	600..630	CDD:293786	8/34 (24%)
		ANK repeat	633..662	CDD:293786	4/10 (40%)
		ANK	661..785	CDD:238125
		ANK repeat	666..697	CDD:293786
		Ank_2	672..762	CDD:289560
		ANK repeat	699..730	CDD:293786
		ANK repeat	732..762	CDD:293786
		ZU5	927..1030	CDD:128514
		Death_ank	1417..1497	CDD:260029
		ER-remodelling	11936..>12013	CDD:258892
SOWAHD	NP_001099046.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..39
		ANK 1	112..141		9/21 (43%)
		ANK	147..>231	CDD:238125	27/89 (30%)
		ANK 2	147..162		7/16 (44%)
		Ank_2	<148..218	CDD:289560	23/69 (33%)
		ANK repeat	148..184	CDD:293786	12/35 (34%)
		ANK repeat	186..218	CDD:293786	10/31 (32%)
		ANK 3	186..216		10/29 (34%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R2336
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	1.030