DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Ank2 and SPBP16F5.05c

DIOPT Version :9

Sequence 1:	NP_001189070.1	Gene:	Ank2 / 38863	FlyBaseID:	FBgn0261788	Length:	13559	Species:	Drosophila melanogaster
Sequence 2:	NP_595779.1	Gene:	SPBP16F5.05c / 2541266	PomBaseID:	SPBP16F5.05c	Length:	146	Species:	Schizosaccharomyces pombe

Alignment Length:	132	Identity:	40/132 - (30%)
Similarity:	73/132 - (55%)	Gaps:	8/132 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly    17 RAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELL--RRGAIVDSATKKGNT 79
            |||....|:.::|  |...:::..:.||.:.||:||.:|||.||.:::  ....::::..:.|||
pombe    11 RAADEELLDEIIE--KCPQELSRRDENGNSGLHMASANGHIAVVQKIIPYLNKEVINAQNESGNT 73

  Fly    80 ALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLL----SNGANQSLAT 140
            |:|.|:|.|..|:.|||||.....::::....:|:|.|...|...|:.|.|    :.|:.::...
pombe    74 AMHWAALNGHAEICKLLLEAGGDPHIKNIYEKSPIYEADIRNQQKVMDLFLDFEIAKGSEENTGD 138

  Fly   141 ED 142
            |:
pombe   139 EE 140

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Ank2	NP_001189070.1	ANK repeat	10..41	CDD:293786	6/23 (26%)
		Ank_4	11..64	CDD:290365	17/46 (37%)
		ANK	38..163	CDD:238125	34/111 (31%)
		ANK repeat	43..74	CDD:293786	11/32 (34%)
		Ank_2	48..135	CDD:289560	31/92 (34%)
		ANK repeat	76..107	CDD:293786	14/30 (47%)
		ANK repeat	109..134	CDD:293786	7/28 (25%)
		Ank_4	110..163	CDD:290365	9/37 (24%)
		Ank_4	172..225	CDD:290365
		ANK repeat	175..202	CDD:293786
		ANK	199..324	CDD:238125
		ANK repeat	204..235	CDD:293786
		Ank_2	209..300	CDD:289560
		ANK repeat	237..268	CDD:293786
		ANK	266..390	CDD:238125
		ANK repeat	270..300	CDD:293786
		ANK repeat	303..367	CDD:293786
		Ank_2	308..399	CDD:289560
		ANK	364..489	CDD:238125
		ANK repeat	369..400	CDD:293786
		ANK repeat	402..433	CDD:293786
		Ank_4	403..456	CDD:290365
		ANK repeat	435..466	CDD:293786
		Ank_2	440..530	CDD:289560
		ANK	463..588	CDD:238125
		ANK repeat	468..497	CDD:293786
		ANK repeat	501..530	CDD:293786
		Ank_2	506..597	CDD:289560
		ANK	529..654	CDD:238125
		ANK repeat	535..565	CDD:293786
		ANK repeat	567..598	CDD:293786
		Ank_2	572..661	CDD:289560
		ANK repeat	600..630	CDD:293786
		ANK repeat	633..662	CDD:293786
		ANK	661..785	CDD:238125
		ANK repeat	666..697	CDD:293786
		Ank_2	672..762	CDD:289560
		ANK repeat	699..730	CDD:293786
		ANK repeat	732..762	CDD:293786
		ZU5	927..1030	CDD:128514
		Death_ank	1417..1497	CDD:260029
		ER-remodelling	11936..>12013	CDD:258892
SPBP16F5.05c	NP_595779.1	ANK	6..124	CDD:238125	37/114 (32%)
		Ank_2	6..101	CDD:289560	31/91 (34%)
		ANK repeat	6..33	CDD:293786	6/23 (26%)
		ANK repeat	35..68	CDD:293786	11/32 (34%)
		ANK repeat	70..101	CDD:293786	14/30 (47%)
		Ank_2	76..>136	CDD:289560	18/59 (31%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R2336
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.940