Sequence 1: | NP_001189070.1 | Gene: | Ank2 / 38863 | FlyBaseID: | FBgn0261788 | Length: | 13559 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_776140.1 | Gene: | Sowahd / 245381 | MGIID: | 3045274 | Length: | 327 | Species: | Mus musculus |
Alignment Length: | 136 | Identity: | 43/136 - (31%) |
---|---|---|---|
Similarity: | 64/136 - (47%) | Gaps: | 24/136 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 508 IAAKEGQDEVAAVLIENGAAL----DAATKKGFTPLHLTAKYG-HIKVAQLLLQKEA-------D 560
Fly 561 VDAQGKNGVTPLHVACHYNNQQVALLLL-EKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYG 624
Fly 625 ALANAE 630 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2336 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.030 |