DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ank2 and Ankrd65

DIOPT Version :9

Sequence 1:NP_001189070.1 Gene:Ank2 / 38863 FlyBaseID:FBgn0261788 Length:13559 Species:Drosophila melanogaster
Sequence 2:NP_001357751.1 Gene:Ankrd65 / 242805 MGIID:2685285 Length:364 Species:Mus musculus


Alignment Length:421 Identity:127/421 - (30%)
Similarity:181/421 - (42%) Gaps:108/421 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 SPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNG 304
            |.|..|..||..::|..||.:|.::|.:...|.||||.|...||..:|.:||:|||...|....|
Mouse    35 STLFQAVWWGAPSLVMQLLRQGSSVEERDHTGRTPLHLAVMRGHAPLVRLLLQRGALAGAPDHTG 99

  Fly   305 LAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALN 369
            ..|||.||            :|                     ||..||                
Mouse   100 RTPLHEAA------------WH---------------------GHSNVA---------------- 115

  Fly   370 GFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMG-CMNIVIYLLQHDASPDVPT 433
                             |||||.|||.:|.:::||||||.||.:| .:.:..:.:..|:..||..
Mouse   116 -----------------ELLLRRGASAAACSQTGLTPLHGAAALGRTLLVTSFTVASDSGSDVKD 163

  Fly   434 VRGETPLHLAARANQTDIIRILLRNG-AQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDA 497
            |||.|..|.||...|..::.:|...| |.:|.       .|.:::..|:...:.|||..||:||.
Mouse   164 VRGWTAAHWAAACGQLAVLELLSAGGNADLDG-------ALLVSAIAGSTSSLQLLLTLGAKVDT 221

  Fly   498 TTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVD 562
            ......|||.:||..|..:...||:::||..:...:...:.||..|..||::|.|||:.|..::|
Mouse   222 QDSTGATALGLAAGLGHHQDIEVLLDHGADPNIRDRNNRSALHRAATGGHLRVTQLLVAKGIEID 286

  Fly   563 AQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALA 627
            ||...|:||||                     || |:.||           :::.:.||:.||..
Mouse   287 AQDSLGLTPLH---------------------HA-ARGGH-----------VEVVSHLLDRGAHI 318

  Fly   628 NAESKAGFTPLHLSSQEGHAEISNLLIEHKA 658
            ||......|||||:.:.||:....||:...|
Mouse   319 NAAGWLHKTPLHLAVENGHSTTVELLLSRGA 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ank2NP_001189070.1 ANK repeat 10..41 CDD:293786
Ank_4 11..64 CDD:290365
ANK 38..163 CDD:238125
ANK repeat 43..74 CDD:293786
Ank_2 48..135 CDD:289560
ANK repeat 76..107 CDD:293786
ANK repeat 109..134 CDD:293786
Ank_4 110..163 CDD:290365
Ank_4 172..225 CDD:290365
ANK repeat 175..202 CDD:293786
ANK 199..324 CDD:238125 31/83 (37%)
ANK repeat 204..235 CDD:293786
Ank_2 209..300 CDD:289560 24/59 (41%)
ANK repeat 237..268 CDD:293786 10/27 (37%)
ANK 266..390 CDD:238125 28/123 (23%)
ANK repeat 270..300 CDD:293786 14/29 (48%)
ANK repeat 303..367 CDD:293786 11/63 (17%)
Ank_2 308..399 CDD:289560 17/90 (19%)
ANK 364..489 CDD:238125 36/126 (29%)
ANK repeat 369..400 CDD:293786 9/30 (30%)
ANK repeat 402..433 CDD:293786 12/31 (39%)
Ank_4 403..456 CDD:290365 20/53 (38%)
ANK repeat 435..466 CDD:293786 11/31 (35%)
Ank_2 440..530 CDD:289560 27/90 (30%)
ANK 463..588 CDD:238125 38/124 (31%)
ANK repeat 468..497 CDD:293786 8/28 (29%)
ANK repeat 501..530 CDD:293786 10/28 (36%)
Ank_2 506..597 CDD:289560 27/90 (30%)
ANK 529..654 CDD:238125 37/124 (30%)
ANK repeat 535..565 CDD:293786 12/29 (41%)
ANK repeat 567..598 CDD:293786 7/30 (23%)
Ank_2 572..661 CDD:289560 23/87 (26%)
ANK repeat 600..630 CDD:293786 7/29 (24%)
ANK repeat 633..662 CDD:293786 10/26 (38%)
ANK 661..785 CDD:238125
ANK repeat 666..697 CDD:293786
Ank_2 672..762 CDD:289560
ANK repeat 699..730 CDD:293786
ANK repeat 732..762 CDD:293786
ZU5 927..1030 CDD:128514
Death_ank 1417..1497 CDD:260029
ER-remodelling 11936..>12013 CDD:258892
Ankrd65NP_001357751.1 ANK repeat 33..63 CDD:293786 10/27 (37%)
PHA03095 49..>347 CDD:222980 121/403 (30%)
ANK repeat 65..96 CDD:293786 15/30 (50%)
ANK repeat 98..123 CDD:293786 16/90 (18%)
ANK repeat 165..223 CDD:293786 20/64 (31%)
ANK repeat 226..256 CDD:293786 10/29 (34%)
ANK repeat 258..289 CDD:293786 12/30 (40%)
ANK repeat 291..320 CDD:293786 14/61 (23%)
ANK repeat 324..354 CDD:293786 10/26 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4177
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.