DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KRT35 and LamC

DIOPT Version :9

Sequence 1:NP_002271.3 Gene:KRT35 / 3886 HGNCID:6453 Length:455 Species:Homo sapiens
Sequence 2:NP_001260974.1 Gene:LamC / 36615 FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster


Alignment Length:458 Identity:120/458 - (26%)
Similarity:194/458 - (42%) Gaps:73/458 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    50 SACSVGLGRSSYRATSCLPALCLPAGGFATSYSGGGGWFGEGILTG--NEKETMQSLNDRLAGYL 112
            ||..|.|.....||::     ..|.||.:||...|.........|.  .|||.:|.||||||.|:
  Fly     2 SARRVTLNTRVSRAST-----STPVGGASTSSRVGATSPTSPTRTSRQQEKEELQHLNDRLACYI 61

Human   113 EKVRQLEQENASLESRI---REWCEQQVPYMCPDYQSYFRTIEELQKKTLCSKAENARLVVEIDN 174
            :::|.||.||:.|...:   ::...::...:...|:.......:|..:|...||:     :|||.
  Fly    62 DRMRNLENENSRLTQELNLAQDTVNRETSNLKAVYEKELAAARKLLDETAKEKAK-----LEIDI 121

Human   175 AKL--AADDFRTKYETEVSLRQLVE----------SDING------------------------- 202
            .:|  ..||.:.:.:.:.....:.|          :::||                         
  Fly   122 KRLWEENDDLKPRLDKKTKEATVAENNARLYENRYNEVNGKYNQSLADRKKFEDQAKELALENER 186

Human   203 LRRILDDL-------TLCKSDLEAQVESLKEELLCLKKNHEEEVNSLR-------CQLGDRLNVE 253
            |||.||||       ||.:.|||.|.:||:|||....:.|.:|:...|       .::..||:.:
  Fly   187 LRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTETRSRRQIEISEIDGRLSRQ 251

Human   254 VDAAPPVDLNRVLEEMRCQYETLVENNRRDAEDWLDTQSEELNQQVVSSSEQLQSCQAEIIELRR 318
            .:|    .|.:.|:|:|.|||..:..||.:.|...|.:.:.| :...:.:.|..:...|.:.|.|
  Fly   252 YEA----KLQQSLQELRDQYEGQMRINREEIELLYDNEIQNL-KAAANRAAQGSALATEEVRLMR 311

Human   319 T-VNALEIELQAQHSMRDALESTLAETEARYSSQLAQMQCMITNVEAQLAEIRADLERQNQEYQV 382
            | ::.|..:||........|.:.:.|.|....::..:....|.::||:|..:|.::..|.||||.
  Fly   312 TKIDGLNAKLQNLEDTNAGLNARIRELENLLDTERQRHNQYIASLEAELQRMRDEMAHQLQEYQG 376

Human   383 LLDVRARLECEINTYRGLLESEDSKLPC-NPCAPDYSPSKSCLPCLPAASCGPSAARTNCSPRPI 446
            |:|::..|:.||..|..||..|:.:|.. :|..|......|.......||....:.|...|.|..
  Fly   377 LMDIKVSLDLEIAAYDKLLCGEERRLNIESPGRPTTDSGISSNGSHLTASASSRSGRVTPSGRRS 441

Human   447 CVP 449
            ..|
  Fly   442 ATP 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KRT35NP_002271.3 Head 1..97 13/48 (27%)
Filament 96..407 CDD:278467 97/365 (27%)
Coil 1A 98..132 16/36 (44%)
Linker 1 133..143 0/9 (0%)
Coil 1B 144..244 35/150 (23%)
Linker 12 245..260 3/14 (21%)
Coil 2 261..404 41/143 (29%)
Tail 405..455 10/46 (22%)
LamCNP_001260974.1 Filament 45..401 CDD:278467 97/365 (27%)
ATP-synt_B <67..>142 CDD:304375 16/79 (20%)
MreC <178..>224 CDD:302802 18/45 (40%)
LTD 473..574 CDD:279300
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.