DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7492 and AT3G63270

DIOPT Version :9

Sequence 1:NP_648146.1 Gene:CG7492 / 38859 FlyBaseID:FBgn0035807 Length:573 Species:Drosophila melanogaster
Sequence 2:NP_567144.1 Gene:AT3G63270 / 825502 AraportID:AT3G63270 Length:396 Species:Arabidopsis thaliana


Alignment Length:336 Identity:67/336 - (19%)
Similarity:134/336 - (39%) Gaps:49/336 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 WTKEWLRKNQTEFLSKENLLSELQSRKDECYHLNYFLAITESQFRYLVQKL-EPIISQYAPQR-- 190
            |...|||.:.....|            ||.|...:|...:::.|.|:...: |.:||: .|..  
plant    45 WDTFWLRNSSPSVPS------------DEDYAFKHFFRASKTTFSYICSLVREDLISR-PPSGLI 96

  Fly   191 --KKKSFSAEERLAITLKYLATGEVHSCRNYCFRASKFVINEMIANICLGFYEHLKDQ---YVTL 250
              :.:..|.|:::||.|:.||:|:........|...:..:::    :...|.|.|:::   ::..
plant    97 NIEGRLLSVEKQVAIALRRLASGDSQVSVGAAFGVGQSTVSQ----VTWRFIEALEERAKHHLRW 157

  Fly   251 PKTD--DQWRSAAEEMERKHNLPHCVGNLFMRSIQLQGSGTASSSGAASSASAVGDDRKRATVIF 313
            |.:|  ::.:|..|||   :.||:|.|.:....|.:       :..|..::....|..|..::..
plant   158 PDSDRIEEIKSKFEEM---YGLPNCCGAIDTTHIIM-------TLPAVQASDDWCDQEKNYSMFL 212

  Fly   314 TGIVDADNNFQYARVERAASSRPNDIYNQTSAIELIRHKM----HALEEQQSAEMDRQGYYFAGD 374
            .|:.|.:..|.............:.:...:...:|..:..    :.....|.|::..   |..|.
plant   213 QGVFDHEMRFLNMVTGWPGGMTVSKLLKFSGFFKLCENAQILDGNPKTLSQGAQIRE---YVVGG 274

  Fly   375 SVLPATSYLVTTRNL--PKD--LAVLEALEQVNAHADQTMRILCNMFPILAQPL-RISDKHIREV 434
            ...|...:|:|..:.  |.|  :|..|..|:|.:.|....:.|...:.||::.: |...:.:..:
plant   275 ISYPLLPWLITPHDSDHPSDSMVAFNERHEKVRSVAATAFQQLKGSWRILSKVMWRPDRRKLPSI 339

  Fly   435 VLGCVALYNFL 445
            :|.|..|:|.:
plant   340 ILVCCLLHNII 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7492NP_648146.1 DDE_Tnp_4 <354..443 CDD:304434 21/93 (23%)
AT3G63270NP_567144.1 HTH 90..136 CDD:419669 10/46 (22%)
DDE_Tnp_4 183..348 CDD:419734 29/174 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D822378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.