DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7492 and AT3G55350

DIOPT Version :9

Sequence 1:NP_648146.1 Gene:CG7492 / 38859 FlyBaseID:FBgn0035807 Length:573 Species:Drosophila melanogaster
Sequence 2:NP_191095.1 Gene:AT3G55350 / 824701 AraportID:AT3G55350 Length:406 Species:Arabidopsis thaliana


Alignment Length:308 Identity:63/308 - (20%)
Similarity:131/308 - (42%) Gaps:37/308 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 SAEERLAITLKYLATGEVHSCRNYCFRASKFVINEMIANICLGFYEHLKDQ---YVTLPKTDDQW 257
            |..:|:|:.|:.|.:||..|.....|..::..:::    |...|.|.::::   :::.|...|:.
plant   110 SLNDRVAVALRRLGSGESLSVIGETFGMNQSTVSQ----ITWRFVESMEERAIHHLSWPSKLDEI 170

  Fly   258 RSAAEEMERKHNLPHCVGNLFMRSIQLQGSGTASSSGAASSASAVG-DDRKRATVIFTGIVDADN 321
            :|   :.|:...||:|.|.:.:..|.:       :..|...::.|. |..|..::....:||.|.
plant   171 KS---KFEKISGLPNCCGAIDITHIVM-------NLPAVEPSNKVWLDGEKNFSMTLQAVVDPDM 225

  Fly   322 NFQYARVERAASSRPNDIYNQTSAIELIRHKMHAL--EEQQSAEMDRQGYYFAGDSVLPATSYLV 384
            .|... :.....|..:|:..:.|....:..|...|  |:...:|......|..|||..|...:|:
plant   226 RFLDV-IAGWPGSLNDDVVLKNSGFYKLVEKGKRLNGEKLPLSERTELREYIVGDSGFPLLPWLL 289

  Fly   385 TT-RNLPKDLAVLEALEQVNAHADQT------MRILCNMFPILAQPLRISDKH-IREVVLGCVAL 441
            |. :..|..|...|..::   |::.|      :..|.:.:.|:...:.:.|:: :..::..|..|
plant   290 TPYQGKPTSLPQTEFNKR---HSEATKAAQMALSKLKDRWRIINGVMWMPDRNRLPRIIFVCCLL 351

  Fly   442 YNFLRKTDDSFRRTSDSIVQQRAEQQQLAYSVDSDEIDDDCIMLATEE 489
            :|.:...:|   :|.|.  |..::|..:.|...|.::.|:...:..:|
plant   352 HNIIIDMED---QTLDD--QPLSQQHDMNYRQRSCKLADEASSVLRDE 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7492NP_648146.1 DDE_Tnp_4 <354..443 CDD:304434 20/98 (20%)
AT3G55350NP_191095.1 DDE_Tnp_4 187..353 CDD:404270 33/176 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D822378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.