DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7492 and si:ch73-257c13.2

DIOPT Version :9

Sequence 1:NP_648146.1 Gene:CG7492 / 38859 FlyBaseID:FBgn0035807 Length:573 Species:Drosophila melanogaster
Sequence 2:XP_005160827.1 Gene:si:ch73-257c13.2 / 566826 ZFINID:ZDB-GENE-081104-269 Length:397 Species:Danio rerio


Alignment Length:437 Identity:87/437 - (19%)
Similarity:143/437 - (32%) Gaps:141/437 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 KNQTEFLSKENLLSELQSRKDECYHLN----------YFLAITE--------SQFRYLVQKLEPI 182
            ||.|.   |....|.::.:.:|...:|          .|.|:.:        |.|:....:.|.:
Zfish    25 KNATR---KRRRASSVKLKNEESVQVNLKREDDDGKVVFNAVLQSLTISDFKSHFQLTPTQTEEL 86

  Fly   183 ISQYAPQR----KKKSFSAEERLAITLKYLATGEVHSCRNYCFRASKFVINEMIANICLGFYEHL 243
            :...||.:    :::.::....:..:|..|:|.|     :|...|::|.:.|.:  ||     ..
Zfish    87 VQLLAPCKWAAIRQEDWTVWHAVLSSLWTLSTQE-----SYQSVANRFHVAESL--IC-----DQ 139

  Fly   244 KDQYVTLPKTD----DQWRSAAEEMERKHNLPHCVGNLFMRSIQLQGSGTASSSGAASSASAVGD 304
            .|::.||..|:    ..| ..|||.:.      ||...|            |:.|...:...||.
Zfish   140 MDEFCTLVTTNLANHIHW-PQAEEADM------CVKGFF------------SAVGLPDTLCVVGT 185

  Fly   305 D----------------RKRATVIFTGIV---DADNNFQYARVERAASSRPNDIYNQ--TSAIEL 348
            .                |......|..::   |....|.|...|     .|.:.:|.  .||.|:
Zfish   186 RLIPIMKPTDVPDSEVYRDTEGAYFAKLMAFCDHKGRFTYVSAE-----HPINWHNSRVLSATEV 245

  Fly   349 IRHKMHALEEQQSAEMDRQGYYFAGDSVLPATSYLVTTRNLP-------KDLAVLEALEQVNAHA 406
            .:    ||:|...|.:  .|.:..|||..|.|.:::|.  .|       |.:...:.:....|..
Zfish   246 GK----ALQEDPVALL--HGKHILGDSTFPLTEHVLTP--FPDYGTFGQKKVCYNQKVRSALAVV 302

  Fly   407 DQTMRILCNMFPILAQPLRISDKH----IREVVLGCVALYNFLRKTDDSFRRTSDSIVQQRAEQQ 467
            ..::..|.:.|    |.|....||    ....|..|..|||...:|                   
Zfish   303 QGSIHTLRSCF----QRLGCLQKHSVCQTSLSVKACCILYNMYLET------------------- 344

  Fly   468 QLAYSVDSDEIDDDCIMLATEE----------ELRERAEFTPSVGLT 504
               |:|..|.:|||.......|          .:.:|.:...|:|.|
Zfish   345 ---YNVIVDCMDDDIPQKPFHELPYGHSGSLGGISKRQDIAASLGRT 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7492NP_648146.1 DDE_Tnp_4 <354..443 CDD:304434 23/99 (23%)
si:ch73-257c13.2XP_005160827.1 DDE_Tnp_4 187..339 CDD:304434 34/168 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D822378at2759
OrthoFinder 1 1.000 - - FOG0000380
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.