DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7492 and harbi2

DIOPT Version :9

Sequence 1:NP_648146.1 Gene:CG7492 / 38859 FlyBaseID:FBgn0035807 Length:573 Species:Drosophila melanogaster
Sequence 2:NP_001122281.1 Gene:harbi2 / 560936 ZFINID:ZDB-GENE-030131-3975 Length:351 Species:Danio rerio


Alignment Length:355 Identity:77/355 - (21%)
Similarity:127/355 - (35%) Gaps:73/355 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 LSKENLLSELQSR---KDECYHLNYFLAITESQFRYLVQKLEPIISQYAPQRKKKSFSAEERLAI 203
            |.:|.::.::|:.   .||  ||......:.....||.:.|||.|..  |.|:..:.:..:.:.|
Zfish    21 LRRERVIRDVQNPLAFSDE--HLYERYRFSAEGMLYLCRLLEPHIKN--PTRRSHATTVPQMICI 81

  Fly   204 TLKYLATG---------EVHSCRNYCFRASKFVIN-EMIANICLGFYEHLKDQYVTLPKTDDQWR 258
            .|::..:|         |..|....|....:.||. :...|..:.|..||..|.:          
Zfish    82 ALRFFTSGTFLYEVGDAEKLSKNTVCRTIRRVVIALQRYINTFVAFPGHLPTQAI---------- 136

  Fly   259 SAAEEMERKHNLPHCVGNLFMRSIQLQGSGTASSSGAASSASAVGDDRKRATVIFTGIVDADNNF 323
              .|...:...||..:|.:....|.:      |:......|:.:   .:.||......:..|:..
Zfish   137 --KEGFSQIAGLPGVIGAIDCIHIPI------STPVKEIEATFL---NRNATHSINVQMTCDHQC 190

  Fly   324 QYARVER--AASSRPNDIYNQTSAIELIRHKMHALEEQQSAEMDRQGYY---FAGDSVLPATSYL 383
            ....::.  ..|.:.|.|:                |:.:..:..:||.:   ..||......|:|
Zfish   191 LITSLDARWPGSMQDNQIF----------------EKSKLCQRFQQGLFDGVLVGDGTYACQSFL 239

  Fly   384 VTTRNLPKDLAVLE---ALEQVNAHADQTMRILCNMFPILAQPLRISDKHIREVVLGCVALYNFL 445
            :|....||.....|   ||.|.....|.|:.||...|..| :.||:|.:...::|..|..|:|..
Zfish   240 LTPYPEPKTKPQHEFNIALSQTRLKIDNTLAILKARFNCL-RDLRVSPERASQIVGACAVLHNIA 303

  Fly   446 RKTDDSFRRTSDSIVQQRAEQQQLAYSVDS 475
                 |.|:.     |..:|.||....|||
Zfish   304 -----SIRKE-----QMPSECQQSNDDVDS 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7492NP_648146.1 DDE_Tnp_4 <354..443 CDD:304434 26/94 (28%)
harbi2NP_001122281.1 DDE_Tnp_4 153..301 CDD:290096 35/173 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.