DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7492 and zgc:113227

DIOPT Version :9

Sequence 1:NP_648146.1 Gene:CG7492 / 38859 FlyBaseID:FBgn0035807 Length:573 Species:Drosophila melanogaster
Sequence 2:NP_001014341.1 Gene:zgc:113227 / 541506 ZFINID:ZDB-GENE-050327-32 Length:415 Species:Danio rerio


Alignment Length:335 Identity:62/335 - (18%)
Similarity:129/335 - (38%) Gaps:64/335 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 ITESQFRYLVQKLEPIISQYAPQRKKKSF----SAEERLAITLKYLATGEVHSCRNYCFRASKFV 227
            ::...|.|:.::|..::     :||..:|    ..::|:||.|..||||..:...:..|......
Zfish    87 VSRESFEYICRRLRHML-----ERKDTNFRLSVPVKKRVAIALCKLATGSEYRYVSQLFGVGVST 146

  Fly   228 INEMIANICLGFYEHLKDQYVTLPKTDDQWRSAAEEMERKHNLPHCVGNLFMRSIQLQGSGTASS 292
            :...:.:.|....:.|...::..| :.::.:..|:..|...|:|.|:|::....|.:        
Zfish   147 VFNCVQDFCSAVIKILVPVHMKFP-SPEKLKEMADVFENCWNVPQCIGSIDAHHIPI-------- 202

  Fly   293 SGAASSASAVGDDRKRA--TVIFTGIVDAD-----------NNFQYARVERAASSRPNDIYNQTS 344
              .|...:..|...::.  :|:...:||.:           .|...|||     .|.:.:::..|
Zfish   203 --IAPEKNPRGYLNRKGWHSVVLQAVVDGNGLFWDLCVGFSGNLSDARV-----LRQSYLWSLLS 260

  Fly   345 AIELIRHKMHALEEQQSAEMDRQ----GYYFAGDSVLPATSYLVTT-----RNLPKDLAVLEALE 400
            ..:|:.|.          ::|..    |||..|||..|..::|:..     ...|:..:....|.
Zfish   261 ERDLLNHN----------KVDISGCDVGYYLIGDSAYPLQNWLMKPFPDIGGLTPQQESFNSRLS 315

  Fly   401 QVNAHADQTMRILCNMFPILAQPLRISDKHIREVVLGCVALYNFLRKTDDSFR--RTSDSI---- 459
            ...:.:|.:.:.|...:..|.:......:.::::.|.|..|:|...:....|.  .::|.:    
Zfish   316 SARSVSDLSFKKLKARWQCLFRRNDCKVELVKKMALTCCVLHNICEEKGTQFSEDHSTDHLNLQP 380

  Fly   460 -VQQRAEQQQ 468
             ||:..|..|
Zfish   381 PVQEFIENGQ 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7492NP_648146.1 DDE_Tnp_4 <354..443 CDD:304434 17/97 (18%)
zgc:113227NP_001014341.1 DDE_Tnp_1 189..358 CDD:279886 34/193 (18%)
DDE_Tnp_4 195..358 CDD:290096 31/187 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 61 1.000 Domainoid score I10427
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D822378at2759
OrthoFinder 1 1.000 - - FOG0000380
OrthoInspector 1 1.000 - - otm25074
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.