DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7492 and CG32187

DIOPT Version :9

Sequence 1:NP_648146.1 Gene:CG7492 / 38859 FlyBaseID:FBgn0035807 Length:573 Species:Drosophila melanogaster
Sequence 2:NP_730303.1 Gene:CG32187 / 39980 FlyBaseID:FBgn0052187 Length:409 Species:Drosophila melanogaster


Alignment Length:360 Identity:78/360 - (21%)
Similarity:133/360 - (36%) Gaps:67/360 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 DLAGILNTRRRLEWTKEWLRKNQTEFLSKENLLSELQSRKDECYH--LNYFLAITESQFR-YL-V 176
            ::..::..:|.|...::  |:|..|   .|:...:|:..|.|.:|  ||.....|::||. || :
  Fly    45 EIFALMQRKRALASGRK--RRNSQE---PEDRKQDLKMPKLEWHHPELNLLHRYTDAQFESYLHM 104

  Fly   177 QKLEPIISQYAPQRK--------KKSFSAEERLAITLKYLATGEVHSCRNYCFRASKFVIN-EMI 232
            :||..:..|.|.::.        ..|..|:..:::.|..|:|.|     ::...|.||.:. .:.
  Fly   105 RKLTFLKIQQALEKTLCGIALPGYPSPPAQTMVSLALWKLSTDE-----HFEEIARKFRLPWALC 164

  Fly   233 ANICLGFYEHLKDQY---VTLPKTDDQWRSAAEEMERKHNLPHCVGNLF----MRSIQLQGSGTA 290
            ..:...|:..:.|.|   :..|.:....||..:..:|...| .|...||    :|.:.:      
  Fly   165 QQVVRAFWHCISDNYESFIKWPNSLAAQRSTLQGYQRLDKL-RCFRELFGIITLRRLDV------ 222

  Fly   291 SSSGAASSASAVGDDRKRATVIFTGIVDADNNFQYARVERAAS-SRPNDIYNQTSAIELIRHKMH 354
                      .:..:.....|:...|.:|:.......||.|.. |..:....||.|:.  ...|.
  Fly   223 ----------FLESEHADVPVVLQLICNAERKIVDCYVELAMEYSFEDSPIGQTLALN--PRTMP 275

  Fly   355 ALEEQQSAEMDRQGYYFAGDSVLPATSYL---VTTRNLPKDLAVLEALEQVNAHADQTMRILCNM 416
            |            |.|..|:.|.|..|||   :......||....|.|......|:|.:..|...
  Fly   276 A------------GSYLIGNDVFPLKSYLMRPIEAECFRKDAMFNEMLRPAFELAEQVLDTLARR 328

  Fly   417 FPILAQPLRISD-KHIREVVLGCVALYNFLRKTDD 450
            |..| ..|...| ..:|.:|....|::|...:.:|
  Fly   329 FNTL-YALEARDLNEVRLIVESICAMHNICEEYED 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7492NP_648146.1 DDE_Tnp_4 <354..443 CDD:304434 23/92 (25%)
CG32187NP_730303.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464967
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D822378at2759
OrthoFinder 1 1.000 - - FOG0000380
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.