DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7492 and CG32095

DIOPT Version :9

Sequence 1:NP_648146.1 Gene:CG7492 / 38859 FlyBaseID:FBgn0035807 Length:573 Species:Drosophila melanogaster
Sequence 2:NP_729755.1 Gene:CG32095 / 317849 FlyBaseID:FBgn0052095 Length:429 Species:Drosophila melanogaster


Alignment Length:375 Identity:85/375 - (22%)
Similarity:140/375 - (37%) Gaps:85/375 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 LSKENLLSELQSRKDECYHLNYFLAITESQFRYLVQKLEPII--SQYAPQRKKKSFSAEERLAIT 204
            ||:|:.|:.|.              :|...|..|.::|.|.:  |....|| :.:.|.|:.:|:.
  Fly   102 LSEEDFLNTLH--------------VTRGTFETLCKQLSPTLRTSDELTQR-EPAISTEKCVALA 151

  Fly   205 LKYLATGEVHSC--------RNYCFRASKFVINEMIANICLGFYEHLKDQYVTLPKTDDQWRSAA 261
            |.:||:||..|.        |....:..|...|.:::.:.....:        ||:......|.|
  Fly   152 LNFLASGERLSLIAERFSLPRPRTIKCLKVFCNAVMSTLGRALRQ--------LPQNPVDCNSVA 208

  Fly   262 EEMERKHNLPHC-VGNLFMRSIQLQGSGTASSSGAASSASAVGDDRK--RATVIFTGIVDADNNF 323
            :..:|:.|:|.. ||.|.:.||.::.:|.|.:|  ......:.|||.  |...:..|:       
  Fly   209 KGFQRESNMPAALVGVLGVCSIPIRSTGEAKNS--ILRMEYLLDDRMLFRELQLGCGL------- 264

  Fly   324 QYARVERAASSRPNDIYNQTSAIELIRHKMHALEEQQSAEMDRQGYYFAGDSVLPATSYLV---T 385
             .|.:....|..||.:    :||...|.....:.....|.: .|.|        |...:|:   |
  Fly   265 -RATLGPMFSHAPNTL----TAIPEFRINSRLVPAFVLAPV-YQNY--------PLRPWLLQRYT 315

  Fly   386 TRNLPKDLAVLEALEQVNAHADQTMRILCNMFPILAQPLRISDKHIREVVLGCVALYNFLRKTDD 450
            ....|.:....|..|.:...:|..:..|.:.:..|:|||.||......::.....|:|.|.:..:
  Fly   316 DPTAPHEHDFNEVAEHLQELSDCALHRLMSRWSFLSQPLDISFHTASCIITAAAVLHNLLEELSE 380

  Fly   451 -------------SFRR--TSDSIVQQRAEQQQ-------LAYSVDSDEI 478
                         .||.  .||| |.:.||...       ||.::.|.||
  Fly   381 PHMLEWGNSVDVSKFRAEPLSDS-VSEDAESHAALEVRDFLARTISSTEI 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7492NP_648146.1 DDE_Tnp_4 <354..443 CDD:304434 18/91 (20%)
CG32095NP_729755.1 ATHILA <66..129 CDD:251715 10/40 (25%)
DDE_Tnp_4 <304..373 CDD:304434 16/76 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458540
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D822378at2759
OrthoFinder 1 1.000 - - FOG0000380
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.