DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7492 and AT3G30525

DIOPT Version :9

Sequence 1:NP_648146.1 Gene:CG7492 / 38859 FlyBaseID:FBgn0035807 Length:573 Species:Drosophila melanogaster
Sequence 2:NP_001326573.1 Gene:AT3G30525 / 28719348 AraportID:AT3G30525 Length:168 Species:Arabidopsis thaliana


Alignment Length:101 Identity:18/101 - (17%)
Similarity:39/101 - (38%) Gaps:17/101 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 QLQGSGTASSSGAASSASAVGDDRKRATVIFTGIVDADNNFQYARVERAASSR----PNDIY--- 340
            :|||........|:.:..|:.|.....|.|:.|..|:.::....::.:.:.|.    |::.|   
plant    13 ELQGMYWNRHDNASLNIMAICDLNMLFTYIWNGAPDSCHDTVVLQIAQQSDSEFHLPPSEKYYLV 77

  Fly   341 -----NQTSAIELIRHKMHALEEQQSAEMDRQGYYF 371
                 |:...:.|.|...:.:.....::     :||
plant    78 DSGYPNKQGFLALYRSSQNRVVRYHMSQ-----FYF 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7492NP_648146.1 DDE_Tnp_4 <354..443 CDD:304434 2/18 (11%)
AT3G30525NP_001326573.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D822378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.