DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7492 and HARBI1

DIOPT Version :9

Sequence 1:NP_648146.1 Gene:CG7492 / 38859 FlyBaseID:FBgn0035807 Length:573 Species:Drosophila melanogaster
Sequence 2:XP_011518327.1 Gene:HARBI1 / 283254 HGNCID:26522 Length:377 Species:Homo sapiens


Alignment Length:340 Identity:62/340 - (18%)
Similarity:130/340 - (38%) Gaps:43/340 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 YLVQKLEPIISQYAPQRKKKSFSAEERLAITLKYLATGEVHSCRNYCFRASKFVINEMIANICLG 238
            |||:.|...:|:  |.::.::.|.|.::...|.:..:|...:........|:..::..:||:...
Human    48 YLVELLGANLSR--PTQRSRAISPETQVLAALGFYTSGSFQTRMGDAIGISQASMSRCVANVTEA 110

  Fly   239 FYEHLKDQYVTLPKTDDQWRSAAEEMERKHNLPHCVG-----NLFMRSIQLQGSGTASSSGAAS- 297
            ..|. ..|::..|..:...::..:|......:|..:|     ::.:::...:.....:..|..| 
Human   111 LVER-ASQFIRFPADEASIQALKDEFYGLAGMPGVMGVVDCIHVAIKAPNAEDLSYVNRKGLHSL 174

  Fly   298 SASAVGDDRKRATVIFTGIVDADNNFQYARVERAASSRPNDIYNQTSAIELIRHKMHALEEQQS- 361
            :...|.|.|.....:.|   :...:.|...|.:.:|        .:|..|...||...|.:... 
Human   175 NCLMVCDIRGTLMTVET---NWPGSLQDCAVLQQSS--------LSSQFEAGMHKDSWLLDLPEF 228

  Fly   362 ------AEMDRQGYYFA------GDSVLPATSYLVTTRNLPKDLAVLE---ALEQVNAHADQTMR 411
                  ..|.|...|..      |||.....::|:|..::|:..|...   |....::..::|.|
Human   229 HWKDWLTVMSRTRIYSTFSSVNQGDSSFFLRTWLMTPLHIPETPAEYRYNMAHSATHSVIEKTFR 293

  Fly   412 ILCNMFPIL---AQPLRISDKHIREVVLGCVALYNF-LRKTDDSFRRTSDSIVQQRAEQQ---QL 469
            .||:.|..|   ...|:.|.:....::|.|..|:|. |....|.:.......::|..|::   ..
Human   294 TLCSRFRCLDGSKGALQYSPEKSSHIILACCVLHNISLEHGMDVWSSPMTGPMEQPPEEEYEHME 358

  Fly   470 AYSVDSDEIDDDCIM 484
            :..:::|.|..:.::
Human   359 SLDLEADRIRQELML 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7492NP_648146.1 DDE_Tnp_4 <354..443 CDD:304434 23/107 (21%)
HARBI1XP_011518327.1 DDE_Tnp_4 148..328 CDD:290096 36/190 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.