DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7492 and LOC110439709

DIOPT Version :9

Sequence 1:NP_648146.1 Gene:CG7492 / 38859 FlyBaseID:FBgn0035807 Length:573 Species:Drosophila melanogaster
Sequence 2:XP_021331564.1 Gene:LOC110439709 / 110439709 -ID:- Length:287 Species:Danio rerio


Alignment Length:229 Identity:56/229 - (24%)
Similarity:100/229 - (43%) Gaps:44/229 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 YEHLKDQYVTLPKTDDQWRSAAEEMERKHNLPHCVGNLFMRSIQLQGSGTASSSGAASSASAVGD 304
            |:.:|..::..|.|:.:||..|.|.:.|...|||:|.|..:.|::|        ..|.|.|...:
Zfish     8 YKVMKKDFLKTPSTEAEWREIAHEFQSKWQFPHCLGALDGKHIRIQ--------PPAKSGSLYHN 64

  Fly   305 DRKRATVIFTGIVDADNNFQYARVERAASSRPND--IYNQTSAIELIRHKMHALEEQQ------- 360
            .:...:||...:|||:..|.||.|  ....|.:|  ::.|:..       ..|:::.|       
Zfish    65 YKSSFSVIMMAVVDANYKFIYASV--GTQGRVSDAGLFAQSDL-------RQAMDQGQLNFPPPE 120

  Fly   361 ---SAEMDRQGYYFAGDSVLPATSYLVTTRNLPKDLAVLEALEQV-NAHADQTMRILCNMFPILA 421
               |::: ...|.|.||...|....|:.    |.....::..::: |....:..|::.|.|.|||
Zfish   121 PLPSSDI-IMPYMFVGDEAYPLRPDLMK----PYPYRQMDHSQRILNYRLSRARRVVENAFGILA 180

  Fly   422 QPLRI--------SDKHIREVVLGCVALYNFLRK 447
            ..||:        .||.:: :.:..:.::||||:
Zfish   181 NRLRVFRSTICLEPDKVVK-ITMASLCIHNFLRE 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7492NP_648146.1 DDE_Tnp_4 <354..443 CDD:304434 21/107 (20%)
LOC110439709XP_021331564.1 DDE_Tnp_4 45..209 CDD:315924 39/186 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D459338at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.