DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7492 and LOC103911715

DIOPT Version :9

Sequence 1:NP_648146.1 Gene:CG7492 / 38859 FlyBaseID:FBgn0035807 Length:573 Species:Drosophila melanogaster
Sequence 2:XP_009303385.1 Gene:LOC103911715 / 103911715 -ID:- Length:408 Species:Danio rerio


Alignment Length:399 Identity:90/399 - (22%)
Similarity:170/399 - (42%) Gaps:72/399 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 RRRLEWTKEWLRKNQT--EFLSKENLLSELQSRKDECYHLNYFLAITESQFRYLVQKLEPIISQY 186
            |:|..|....|.:.:.  :|   ..|:.||:...|. :| .|| .::.|||..|::.:.|.:.: 
Zfish    25 RKRRYWVHPILEEREVHGDF---RRLIKELKLYHDR-FH-RYF-RVSVSQFESLLKLVAPSLCK- 82

  Fly   187 APQRKKKSFSAEERLAITLKYLATGEVHSCRNYCFRASKF-----VINEMIANICLGFYEHLKDQ 246
            :....:|..:.|:|||:.|::|.||:     :|...||..     .:..::|..|...:..|||:
Zfish    83 SRTNFRKPINPEQRLAVCLRFLGTGD-----SYRTIASSLSLGISTVARVVAETCDAIWSCLKDE 142

  Fly   247 YVTLPKTDDQWRSAAEEMERKHNLPHCVGNLFMRSIQLQGSGTASSSGAASSASAVGDDRKRATV 311
            |:.:| |:|.|||.|:..:.:.:||:|:|.:..:.|.:|..|        :||:.:.|.:...:|
Zfish   143 YMPVP-TEDVWRSIAKRFQERWSLPNCLGVIDGKRIAVQSPG--------NSATFLYDYKGTFSV 198

  Fly   312 IFTGIVDADNNFQYARVERAASSRPNDIYNQTS---AIELIRHKMHALEEQQSA-EMDRQGYYFA 372
            :...:.|||..|....|....||....|:..::   |::.......|..|...| |:.:..:...
Zfish   199 VLLTLTDADYRFLVVDVGSCGSSSDVGIFTNSALGKALQDGAFNFPAPAELPGAPELGKVNHVIV 263

  Fly   373 GDSVLPATSYLVTTRNLPKDLAVLEALEQVNAHADQTMRILCNMFPILAQPLRISDKHIR----- 432
            .:...|...||:  |..| ...:|..::..|....:..::..|.|..|:|..|...:.::     
Zfish   264 ANETFPLKPYLL--RPYP-GRQLLPEMKVFNCRLSRARQVSENCFSNLSQRFRFFQRRLQVSPAV 325

  Fly   433 ---EVVLGCVALYNFLRKTDDSFRRTSDSIVQQRAEQQQLAYSVDSDEIDDD---CIMLATEEEL 491
               .|...|: |.|::..::.:.:                      |..:||   |:::   |.|
Zfish   326 ADSAVKAACI-LCNYVSPSEQNIQ----------------------DLQEDDGSGCVVI---EPL 364

  Fly   492 RERAEFTPS 500
            |:...:..|
Zfish   365 RQMGGYRAS 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7492NP_648146.1 DDE_Tnp_4 <354..443 CDD:304434 19/97 (20%)
LOC103911715XP_009303385.1 DDE_Tnp_4 172..338 CDD:290096 35/177 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D459338at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.