DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7492 and si:dkey-121j17.6

DIOPT Version :9

Sequence 1:NP_648146.1 Gene:CG7492 / 38859 FlyBaseID:FBgn0035807 Length:573 Species:Drosophila melanogaster
Sequence 2:XP_005164484.1 Gene:si:dkey-121j17.6 / 101886441 ZFINID:ZDB-GENE-121214-361 Length:429 Species:Danio rerio


Alignment Length:291 Identity:71/291 - (24%)
Similarity:133/291 - (45%) Gaps:28/291 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 ITESQFRYLVQKLEPIIS-QYAPQRKKKSFSAEERLAITLKYLATGEVHSCRNYCFRASKFVINE 230
            :|..:|.:|:..:.|:|: |:...|  ::.:|::||.:||.:|||||..|..:..::......::
Zfish    68 MTSEEFEFLLSVVGPLITKQHTKMR--RAITAKDRLYVTLLFLATGETFSSLSAQYKIGASTTSQ 130

  Fly   231 MIANICLGFYEHLKDQYVTLPKTDDQWRSAAEEMERKHNLPHCVGNLFMRSIQLQGSGTASSSGA 295
            ::...|...|:.:|..|:..|.|:.:||:.|.:.|.|...|||:|.|..:.|.:|          
Zfish   131 IVMETCAALYQVMKKDYLKTPSTEAEWRTIAHDFESKWQFPHCLGALGGKRIYIQ---------- 185

  Fly   296 ASSASAVGDDRK-RATVIFTGIVDADNNFQYARVERAASSRPNDIYNQTSAIELIRHKMHAL--- 356
            ..:.:...|:.| |..|..|..|||:..|.|..|:...::.....:.|:.   |.:.....|   
Zfish   186 PPAKTGTFDNYKGRCFVTATAAVDANYKFIYISVDTHVTASDAGPFAQSG---LCKWMDSGLLNC 247

  Fly   357 ---EEQQSAEMDRQGYYFAGDSVLPATSYLVT---TRNLPKDLAVLE-ALEQVNAHADQTMRILC 414
               |...::|: :..|.|.||...|....|:|   ::...:...:|. .|.:....||....||.
Zfish   248 PPPEPLANSEL-KIPYMFVGDETYPLRPDLMTPYPSKPTDRSQQILNYRLSRAQRAADNAFGILA 311

  Fly   415 NMFPILAQPLRISDKHIREVVLGCVALYNFL 445
            |.|..|...:.:..:.:.:::...:.::|||
Zfish   312 NRFRFLRNTIYLEPEKVLKILTASLCIHNFL 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7492NP_648146.1 DDE_Tnp_4 <354..443 CDD:304434 19/98 (19%)
si:dkey-121j17.6XP_005164484.1 HTH_Tnp_4 96..144 CDD:290344 13/47 (28%)
DDE_Tnp_4 177..340 CDD:304434 35/176 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 61 1.000 Domainoid score I10427
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D459338at33208
OrthoFinder 1 1.000 - - FOG0000380
OrthoInspector 1 1.000 - - otm25074
orthoMCL 1 0.900 - - OOG6_103446
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.