DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7492 and LOC101733137

DIOPT Version :9

Sequence 1:NP_648146.1 Gene:CG7492 / 38859 FlyBaseID:FBgn0035807 Length:573 Species:Drosophila melanogaster
Sequence 2:XP_004920283.2 Gene:LOC101733137 / 101733137 -ID:- Length:590 Species:Xenopus tropicalis


Alignment Length:339 Identity:62/339 - (18%)
Similarity:122/339 - (35%) Gaps:63/339 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 ITESQFRYLVQKLEPIISQYAPQRKKKSFSAEERLAITLKYLATGEVHSCRNYCFRASKFVINEM 231
            :|:|.|.||..:|.|.:.:..|. ..::...|.||||||..|.:...:......|..|:..|..:
 Frog   265 MTKSTFDYLCDQLRPAMQKTVPD-AGQTMPLEVRLAITLWRLGSSSPYRTNENIFGVSRSAIVMI 328

  Fly   232 IANICLGFYEHLKDQYVTLPKTDDQWRSAAEEMERKHNLPHCVGNLFMRSIQLQGSGTASSSGAA 296
            :.::|.........:::.:| ..:..:......|.:|.||...|.:....:.:|        ..|
 Frog   329 VRDVCEAIISVFTPRFIRVP-CGNTLQDTLRGFEEQHGLPQLAGVVGTLHVAIQ--------TPA 384

  Fly   297 SSASAVGDDRKRATVIFTGIVDADNNFQYARVERAASSRPNDIYNQTSAIELIRHKMHALEEQ-- 359
            ..:....:::...:|:...:|:||..|....::...        |.:.:..|:..:::.:..:  
 Frog   385 EKSGQYFNNKGWHSVVVQAVVNADLCFWDLNIDCPG--------NLSDSQVLVSSELYKMANRGT 441

  Fly   360 --QSAEMDRQG----YYFAGDSVLPATSYLVT-------------TRNLPKDLAVLE-ALEQVNA 404
              .|:..:.:|    .:..|....|...:|:|             .|.....|.|:: |.|::..
 Frog   442 LFPSSTRNVKGLEVPIHLLGPRSYPLLPWLMTPFTEETGRECGELNRQFSSALGVIDMAFERLKG 506

  Fly   405 HADQTMRILC----NMFPILAQPLRISDKHIREVVLGCVALYNFLRKTDDSFRRTSDSIVQQRAE 465
                  |..|    |.|.:...|         .::..|..|:|......|.|......:    |.
 Frog   507 ------RWCCLLKSNDFDLCLLP---------TLITACCTLHNICEHRGDPFEEHWLEV----AA 552

  Fly   466 QQQLAYSVDSDEID 479
            ::.|....:|||.|
 Frog   553 EEDLEQPSESDEED 566

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7492NP_648146.1 DDE_Tnp_4 <354..443 CDD:304434 18/114 (16%)
LOC101733137XP_004920283.2 DDE_Tnp_4 373..534 CDD:419734 27/191 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D822378at2759
OrthoFinder 1 1.000 - - FOG0000380
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.