DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7492 and zmp:0000000634

DIOPT Version :9

Sequence 1:NP_648146.1 Gene:CG7492 / 38859 FlyBaseID:FBgn0035807 Length:573 Species:Drosophila melanogaster
Sequence 2:XP_009300611.1 Gene:zmp:0000000634 / 100536291 ZFINID:ZDB-GENE-130530-637 Length:430 Species:Danio rerio


Alignment Length:383 Identity:73/383 - (19%)
Similarity:130/383 - (33%) Gaps:115/383 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 NLLSELQSRKDECYHLNYFLAITESQFRYLVQKLEPIISQYAPQRK----KKSFSAEERLAITLK 206
            |:|:..    |:...:.:| .::.:.|.:::|.|.|.:     :||    :|......|||:.|.
Zfish    93 NILNNF----DDGMWMQHF-RMSRNTFEFVLQLLSPSL-----KRKTTGWRKPLEPRLRLAVVLW 147

  Fly   207 YLATGEVHSCRNYCFRASKFVINEMIANICL------GFYEHLKDQYVTLPKTDDQWRSAAEEME 265
            :.||...       :|....:....|:.:|:      ...:.|.::::.|||.:           
Zfish   148 WYATPSE-------YRTISCLFGLGISTVCMLVRQVTNALKTLCERFICLPKGE----------- 194

  Fly   266 RKHNLPHCVGNLFMRSIQLQGSGTASSSGAASSA----------SAVGDDRKR-ATVIFTGIVDA 319
               .|...:...|.|       |....:||....          .|...:||. .:::...:|  
Zfish   195 ---RLQKTIDGFFAR-------GYKMCAGAIDGCHIPILKPHVDQAAYCNRKGWHSIVLQAVV-- 247

  Fly   320 DNNFQYARVERAASSRPND--------IYNQTSAIELIRHKMHALEEQQSAEMD--RQGYYFAGD 374
            |:||.:..|......|.:|        ||....|     |..:....::|..:|  ....:..||
Zfish   248 DHNFCFTDVYVGWPGRTHDARVLANSPIYQMAEA-----HDGYLFPREKSTVVDGVEVPIHLIGD 307

  Fly   375 SVLPATSYLVTTRNLPKDLAVLEALEQVNAH----ADQTMRILCNMFPILAQP----LRISDKHI 431
            :..|...:|:      |.....:.|....:|    ......::.|.|..|...    |:.:|..|
Zfish   308 AAYPLKKWLM------KGFLNHQILTPDQSHFNFCLSSARMVVENSFGRLKGRWRCLLKRNDVDI 366

  Fly   432 R---EVVLGCVALYNF--LRK-------------------TDDSFRR-TSDSIVQQRA 464
            .   ::|:.|..|:|.  |||                   ||....| |.|:...:||
Zfish   367 NIMSDIVVACCILHNICELRKERYLPEWNTDLQCDVSADVTDREHNRITDDAQAVRRA 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7492NP_648146.1 DDE_Tnp_4 <354..443 CDD:304434 18/101 (18%)
zmp:0000000634XP_009300611.1 DDE_Tnp_1 207..361 CDD:279886 30/166 (18%)
DDE_Tnp_4 215..381 CDD:290096 32/178 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D822378at2759
OrthoFinder 1 1.000 - - FOG0000380
OrthoInspector 1 1.000 - - otm25074
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.