DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7492 and LOC100493151

DIOPT Version :9

Sequence 1:NP_648146.1 Gene:CG7492 / 38859 FlyBaseID:FBgn0035807 Length:573 Species:Drosophila melanogaster
Sequence 2:XP_012825361.1 Gene:LOC100493151 / 100493151 -ID:- Length:327 Species:Xenopus tropicalis


Alignment Length:214 Identity:46/214 - (21%)
Similarity:71/214 - (33%) Gaps:61/214 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 YVTLPKTDDQWRSAAEEMERKHNLPHCVGNLFMRSIQLQGSGTASSSGAASSASAVG------DD 305
            |..:..:||....|..|::.........|.      |:.|. .|.|..||.:|:||.      .:
 Frog   120 YTCIFASDDHVDFATLELKEAPPADSLTGG------QIVGI-VAGSIAAAVAAAAVALGWCHFKN 177

  Fly   306 RKRATVIFTGIVDADNNFQYARVERAASSRPNDIYNQTSAIELIRHKMHALEEQQSAEMDRQGYY 370
            |:|           |......|.|     ..||:..:... ||||                    
 Frog   178 RRR-----------DKELAQLRTE-----LKNDLKRERMK-ELIR-------------------- 205

  Fly   371 FAGDSVLPATSYLVTTRNLPKDLAVLEALEQVNAHA----DQTMRILCNMFPILAQ---PLRISD 428
               |:..|...:|:|..:.|:.||. .|..|.:..|    ::|..:|.:.|..|.:   .|..|.
 Frog   206 ---DAGYPCGRWLITPIHRPRSLAD-RAFNQAHVRARSVIERTFGVLKSWFRCLDKSGGSLMYSP 266

  Fly   429 KHIREVVLGCVALYNFLRK 447
            ..:...|..|..|:|...:
 Frog   267 TKVANFVGACAVLHNLANR 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7492NP_648146.1 DDE_Tnp_4 <354..443 CDD:304434 19/95 (20%)
LOC100493151XP_012825361.1 Ig 41..138 CDD:299845 5/17 (29%)
IG_like 49..138 CDD:214653 5/17 (29%)
DDE_Tnp_4 <206..281 CDD:304434 19/75 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D822378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.