DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7492 and LOC100487167

DIOPT Version :9

Sequence 1:NP_648146.1 Gene:CG7492 / 38859 FlyBaseID:FBgn0035807 Length:573 Species:Drosophila melanogaster
Sequence 2:XP_031759139.1 Gene:LOC100487167 / 100487167 -ID:- Length:465 Species:Xenopus tropicalis


Alignment Length:381 Identity:68/381 - (17%)
Similarity:128/381 - (33%) Gaps:119/381 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 RRRLEWTKEW----------------LRKNQTEFLSKENLLSELQSRKDECYHLNYFLAITESQF 172
            ::|.:|.:..                ||||..:|.:                    ::.::.|.|
 Frog    98 KKRRQWVQPMCYQRFSKGQFHLLYGKLRKNPEKFFA--------------------YIRMSISTF 142

  Fly   173 RYLVQKLEPIISQYAPQRKKKSFSAEERLAITLKYLATGEVHSCRNYCFRASKFVINEMIANICL 237
            ..|::.:.|.:.: .....:::.|..|||.:||::||||...:..:|.|...:..|..::...|.
 Frog   143 DELLKLVHPHLHR-MDTNMRQAISPAERLVVTLRFLATGSTFAALHYQFLIGRATIGMIVRETCK 206

  Fly   238 GFYEHLKDQYVTLPKTDDQWRSAAEEMERKHNLPHCVGNLFMRSIQLQGSGTASSSGAASSASAV 302
            ..:...||..:..|.| ::|...||....|.:.|:|:|.|..:.|::    |...:..:.|.|  
 Frog   207 TIWNVTKDLVMPEPNT-EKWMKIAEGFYEKTDFPNCIGALDGKHIRV----TRPPNTVSKSCS-- 264

  Fly   303 GDDRKRATVIFT---GIVDADNNFQYARVERAASSRPNDIYNQTSAIELIRHKMHALEEQQSAEM 364
                   .|.||   .:||:...|.|..|....|                             :.
 Frog   265 -------KVFFTVLLALVDSSYCFTYIDVGAYGS-----------------------------DG 293

  Fly   365 DRQGYY--------------FAGDSVLPATS-----YLVTT----------------RNLP-KDL 393
            |..|::              |..:..||.|.     |::..                |||. ...
 Frog   294 DASGFFKSNLGKMVNEGKLNFPANKPLPGTKGPALPYVIVADEAFGISTNVMRPYPIRNLTGTKR 358

  Fly   394 AVLEALEQVNAHADQTMRILCNMFPILAQPLRISDKHIREVVLGCVALYNFLRKTD 449
            |....|.:.....:....||.|.:.:....::::...:.:::.....|:|.:...|
 Frog   359 AFNYRLTRARRMVECAFGILANKWRVFHSAIQLNTAFVDDIIKCACVLHNLVLLRD 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7492NP_648146.1 DDE_Tnp_4 <354..443 CDD:304434 16/124 (13%)
LOC100487167XP_031759139.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 115 1.000 Inparanoid score I4676
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D459338at33208
OrthoFinder 1 1.000 - - FOG0000380
OrthoInspector 1 1.000 - - otm48301
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.