DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SD and Pglyrp1

DIOPT Version :9

Sequence 1:NP_648145.1 Gene:PGRP-SD / 38858 FlyBaseID:FBgn0035806 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_445825.1 Gene:Pglyrp1 / 84387 RGDID:621429 Length:183 Species:Rattus norvegicus


Alignment Length:164 Identity:66/164 - (40%)
Similarity:99/164 - (60%) Gaps:2/164 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 IVTRAEWNAKPPNGAIDSMETPLPRAVIAHTAGGACADDVTCSQHMQNLQNFQMSKQKFSDIGYH 86
            :|.|:||.|. |:.....::.|:...||:||||..|:...:|.|..:|:|.:||.:..:.|:.|:
  Rat    21 VVPRSEWKAL-PSECSKGLKKPVRYVVISHTAGSFCSSPDSCEQQARNVQLYQMKQLGWCDVAYN 84

  Fly    87 YLIGGNGKVYEGRSPSQRGAFAGPN-NDGSLGIAFIGNFEERAPNKEALDAAKELLEQAVKQAQL 150
            :|||.:|.|||||..:.:|...||. |..|:||.|:|::..|.|.|.||.||..||:..|.:..|
  Rat    85 FLIGEDGHVYEGRGWTIKGDHTGPIWNPMSIGITFMGDYSHRVPAKRALRAALNLLKCGVSEGFL 149

  Fly   151 VEGYKLLGHRQVSATKSPGEALYALIQQWPNWSE 184
            ...|::.|||.|.:|.|||:.||.:||.|.::.|
  Rat   150 RSNYEVKGHRDVQSTLSPGDQLYEIIQSWDHYRE 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SDNP_648145.1 PGRP 20..162 CDD:128941 55/140 (39%)
Pglyrp1NP_445825.1 PGRP 21..161 CDD:128941 55/140 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345824
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5479
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46811
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101717
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.620

Return to query results.
Submit another query.