DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SD and pglyrp1-like.1

DIOPT Version :9

Sequence 1:NP_648145.1 Gene:PGRP-SD / 38858 FlyBaseID:FBgn0035806 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001025626.1 Gene:pglyrp1-like.1 / 595014 XenbaseID:XB-GENE-5778936 Length:182 Species:Xenopus tropicalis


Alignment Length:186 Identity:76/186 - (40%)
Similarity:104/186 - (55%) Gaps:10/186 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTWIGLLIVGLTAIAVQGEVPIVTRAEWNAKPPNGAIDSMETPLPRAV----IAHTAGGACADDV 61
            |.|:.:.:....|:| ||...|::|:.|...|     ...:..|||:|    |.||||.:|..:.
 Frog     1 MMWVFIFLTAFCALA-QGCPKIISRSSWGGVP-----SKCQAKLPRSVKYVIIHHTAGASCNSES 59

  Fly    62 TCSQHMQNLQNFQMSKQKFSDIGYHYLIGGNGKVYEGRSPSQRGAFAGPNNDGSLGIAFIGNFEE 126
            .|....:|:|||.|....:.|.||::|||.:|:|||||.....||.|...|..|:||:|:|.|..
 Frog    60 ACKAQARNIQNFHMKSNGWCDTGYNFLIGEDGQVYEGRGWETVGAHAKNYNFNSIGISFMGTFTN 124

  Fly   127 RAPNKEALDAAKELLEQAVKQAQLVEGYKLLGHRQVSATKSPGEALYALIQQWPNW 182
            ||||..|..|||:|:...|.:..:...|.|.|||.||||:.||..||.||:.|||:
 Frog   125 RAPNTAAQKAAKDLISCGVAKKVINSDYTLKGHRDVSATECPGTNLYNLIKNWPNF 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SDNP_648145.1 PGRP 20..162 CDD:128941 57/145 (39%)
pglyrp1-like.1NP_001025626.1 PGRP 19..160 CDD:128941 57/145 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46811
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.