DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SD and PGLYRP4

DIOPT Version :9

Sequence 1:NP_648145.1 Gene:PGRP-SD / 38858 FlyBaseID:FBgn0035806 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_065126.2 Gene:PGLYRP4 / 57115 HGNCID:30015 Length:373 Species:Homo sapiens


Alignment Length:168 Identity:60/168 - (35%)
Similarity:95/168 - (56%) Gaps:16/168 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 IVTRAEWNAKPPNGAIDSMETPLPR-------AVIAHTAGGACADDVTCSQHMQNLQNFQMSKQK 79
            :|.|:.|.|:         ||..||       .:|.||||..|.....|...::::|:|.:.:.|
Human   213 VVPRSVWGAR---------ETHCPRMTLPAKYGIIIHTAGRTCNISDECRLLVRDIQSFYIDRLK 268

  Fly    80 FSDIGYHYLIGGNGKVYEGRSPSQRGAFAGPNNDGSLGIAFIGNFEERAPNKEALDAAKELLEQA 144
            ..||||::|:|.:|.:|||...:.:|:.....:|.:|||.|:|.|....||..||:||::|::.|
Human   269 SCDIGYNFLVGQDGAIYEGVGWNVQGSSTPGYDDIALGITFMGTFTGIPPNAAALEAAQDLIQCA 333

  Fly   145 VKQAQLVEGYKLLGHRQVSATKSPGEALYALIQQWPNW 182
            :.:..|...|.|:||..|:.|.|||:|||.:|..||::
Human   334 MVKGYLTPNYLLVGHSDVARTLSPGQALYNIISTWPHF 371

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
PGRP-SDNP_648145.1 PGRP 20..162 CDD:128941 49/146 (34%)
PGLYRP4NP_065126.2 PGRP 53..194 CDD:128941
PGRP 211..351 CDD:128941 49/146 (34%)
Interaction with murein 293..302 1/8 (13%)