DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SD and pglyrp2

DIOPT Version :9

Sequence 1:NP_648145.1 Gene:PGRP-SD / 38858 FlyBaseID:FBgn0035806 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001038631.1 Gene:pglyrp2 / 568634 ZFINID:ZDB-GENE-071227-1 Length:458 Species:Danio rerio


Alignment Length:168 Identity:58/168 - (34%)
Similarity:91/168 - (54%) Gaps:4/168 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 IVTRAEWNAKPPNGAIDSMETPLPRAVIAHTA--GGACADDVTCSQHMQNLQNFQMSKQKFSDIG 84
            |:.|..|.|.||...::.:..|:....|.|||  ...|.:..||||:|:.:|.|......:.|||
Zfish   287 IIPRCIWGAAPPQVPLELLSPPMSFLYIHHTAIPSKPCLNLQTCSQNMRAMQRFHQKDWGWYDIG 351

  Fly    85 YHYLIGGNGKVYEGRSPSQRGAFAGPNNDGSLGIAFIGNFEERAPNKEALDAAK-ELLEQAVKQA 148
            |.:::|.:|.:||||....:||.....|:...|:||||::..|.|:...::..: .|::..|...
Zfish   352 YSFVVGSDGYIYEGRGWMSQGAHTKGRNNVGYGVAFIGDYSGRLPSTHDMELVRHHLVKCGVNNG 416

  Fly   149 QLVEGYKLLGHRQVSATKS-PGEALYALIQQWPNWSEE 185
            .|.|.:.:||||||..|.| ||.|||:.|..|.::.::
Zfish   417 FLQEDFTILGHRQVVVTTSCPGNALYSEITTWMHYKDK 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SDNP_648145.1 PGRP 20..162 CDD:128941 47/142 (33%)
pglyrp2NP_001038631.1 PGRP 285..430 CDD:128941 47/142 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586823
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101717
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.710

Return to query results.
Submit another query.