DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SD and PGRP-SB2

DIOPT Version :9

Sequence 1:NP_648145.1 Gene:PGRP-SD / 38858 FlyBaseID:FBgn0035806 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001261970.1 Gene:PGRP-SB2 / 39869 FlyBaseID:FBgn0043577 Length:191 Species:Drosophila melanogaster


Alignment Length:181 Identity:59/181 - (32%)
Similarity:90/181 - (49%) Gaps:23/181 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IGLLIVGLTAIAVQGEVPIVTRAEWNAKPPNGAIDSMETPLPRAVIAHTAGGACADDVTCSQHMQ 68
            :.|::.|||....|    ||.|:.|...|.:..:..:..|:...:|.||....|.:...|...::
  Fly     5 LALVLCGLTLALGQ----IVPRSSWCPVPISPRMPRLMVPVRLIIIHHTVTAPCFNPHQCQLVLR 65

  Fly    69 NLQNFQMSKQKFSDIGYHYLIGGNGKVYEGRSPSQRGAFAGPNNDGSLGIAFIGNFEERA----- 128
            .::...| ::||.||||::||||:|::|||.....||..|...|..|:||||||||:...     
  Fly    66 QIRADHM-RRKFRDIGYNFLIGGDGRIYEGLGFGIRGEHAPRYNSQSIGIAFIGNFQNAPGCPNP 129

  Fly   129 -PNKEALDAAKELLEQAVKQAQLV-EGYKLLGH------RQVS--ATKSPG 169
             ||:   .||.....|..:...|. ||:.|.|:      ::|:  |||:.|
  Fly   130 HPNR---CAASPGFAQLFRGGSLPNEGHCLSGNTPSQRAQKVAKLATKALG 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SDNP_648145.1 PGRP 20..162 CDD:128941 49/154 (32%)
PGRP-SB2NP_001261970.1 PGRP 18..>129 CDD:128941 40/115 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440253
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.