DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SD and PGRP-LD

DIOPT Version :9

Sequence 1:NP_648145.1 Gene:PGRP-SD / 38858 FlyBaseID:FBgn0035806 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001137893.1 Gene:PGRP-LD / 3771920 FlyBaseID:FBgn0260458 Length:327 Species:Drosophila melanogaster


Alignment Length:202 Identity:51/202 - (25%)
Similarity:91/202 - (45%) Gaps:37/202 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 W--IGLLIVGLTAIAV-------QGEVP-------IVTRAEWNAKPPNGAIDSMETPL--PRAVI 49
            |  :|||::..:|:|:       |.:.|       ||....|:.....|. .::..|:  ...:.
  Fly   136 WRSVGLLVMCASALALAAYLLWRQTQTPDFGYRLSIVGHGIWSDMELQGR-GTLFDPIGVGTVIF 199

  Fly    50 AHTAGGACADDVTCSQHMQNLQNFQMSKQKFSDIGYHYLIGGNGKVYEGRSPSQRGAFAGP-NND 113
            .||....|.||  |...:..|:     :....::.|::|:.|:.:|:|.:....|..:... |..
  Fly   200 THTGSNECHDD--CPDVLHKLE-----RSHVGELPYNFLVAGDCQVFEAQGWHYRSQYPRDLNGI 257

  Fly   114 GSLGIAFIGNFEERAPNKEALDAAKELLEQAVKQAQLVEGYKL--LGHRQVSATKSPGEALYALI 176
            .||.:||:|||..|.|....|.||:.|:.:::|:..|...|:|  ||        |..:||...:
  Fly   258 DSLVMAFVGNFSGRPPIDCQLMAAQALILESLKRRILQPIYQLFVLG--------SYTDALQREL 314

  Fly   177 QQWPNWS 183
            :.||:::
  Fly   315 RHWPHYA 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SDNP_648145.1 PGRP 20..162 CDD:128941 39/153 (25%)
PGRP-LDNP_001137893.1 PGRP 169..306 CDD:128941 38/152 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440231
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.