DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SD and PGRP-SA

DIOPT Version :9

Sequence 1:NP_648145.1 Gene:PGRP-SD / 38858 FlyBaseID:FBgn0035806 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001285128.1 Gene:PGRP-SA / 32099 FlyBaseID:FBgn0030310 Length:203 Species:Drosophila melanogaster


Alignment Length:188 Identity:73/188 - (38%)
Similarity:105/188 - (55%) Gaps:11/188 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IGLLIVGLTAIAVQGE---------VPIVTRAEWNAKPPNGAIDSMETPLPRAVIAHTAGGACAD 59
            |||::: |.|....|:         ..|..:.:|..||..| :.....|:...||.||..|.|:.
  Fly    14 IGLVLL-LLAFVSAGKSRQRSPANCPTIKLKRQWGGKPSLG-LHYQVRPIRYVVIHHTVTGECSG 76

  Fly    60 DVTCSQHMQNLQNFQMSKQKFSDIGYHYLIGGNGKVYEGRSPSQRGAFAGPNNDGSLGIAFIGNF 124
            .:.|::.:||:|.:..::..|:||.|::|||.:|.||||.....|||.....|....||||||||
  Fly    77 LLKCAEILQNMQAYHQNELDFNDISYNFLIGNDGIVYEGTGWGLRGAHTYGYNAIGTGIAFIGNF 141

  Fly   125 EERAPNKEALDAAKELLEQAVKQAQLVEGYKLLGHRQVSATKSPGEALYALIQQWPNW 182
            .::.|:..||.|||:||...|:|.:|.|.|.|:...||.:|:|||..||..||:||:|
  Fly   142 VDKLPSDAALQAAKDLLACGVQQGELSEDYALIAGSQVISTQSPGLTLYNEIQEWPHW 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SDNP_648145.1 PGRP 20..162 CDD:128941 54/141 (38%)
PGRP-SANP_001285128.1 PGRP 38..179 CDD:128941 54/141 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440249
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5479
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7191
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101717
Panther 1 1.100 - - P PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.700

Return to query results.
Submit another query.