DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SD and Pglyrp3

DIOPT Version :9

Sequence 1:NP_648145.1 Gene:PGRP-SD / 38858 FlyBaseID:FBgn0035806 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_006501534.1 Gene:Pglyrp3 / 242100 MGIID:2685266 Length:359 Species:Mus musculus


Alignment Length:170 Identity:66/170 - (38%)
Similarity:99/170 - (58%) Gaps:8/170 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 EVP------IVTRAEWNAKPPNGAIDSMETPLPRAVIAHTAGGACADDVTCSQHMQNLQNFQMSK 77
            |:|      |..|:.|.|:..:  ...|..|....:|.||||.:|.:...|...:::.|:|.:..
Mouse   190 EIPKKACPNITPRSAWEARETH--CPQMNLPAKFVIIIHTAGKSCNESADCLVRVRDTQSFHIDN 252

  Fly    78 QKFSDIGYHYLIGGNGKVYEGRSPSQRGAFAGPNNDGSLGIAFIGNFEERAPNKEALDAAKELLE 142
            |.|.||.||:|:|.:|:||||...:..|:.....||.:|||||:|||.|:.||:.:|.||:.|::
Mouse   253 QDFCDIAYHFLVGQDGEVYEGVGWNIEGSHTYGYNDIALGIAFMGNFVEKPPNEASLKAAQSLIQ 317

  Fly   143 QAVKQAQLVEGYKLLGHRQVSATKSPGEALYALIQQWPNW 182
            .||.:..|...|.|:||..||...|||:|||.:|:.||::
Mouse   318 CAVAKGYLTSNYLLMGHSDVSNILSPGQALYNIIKTWPHF 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SDNP_648145.1 PGRP 20..162 CDD:128941 54/147 (37%)
Pglyrp3XP_006501534.1 PGRP 40..172 CDD:128941
PGRP 197..337 CDD:128941 53/141 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842403
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5479
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7191
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101717
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.550

Return to query results.
Submit another query.