DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SD and Pglyrp1

DIOPT Version :9

Sequence 1:NP_648145.1 Gene:PGRP-SD / 38858 FlyBaseID:FBgn0035806 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_033428.1 Gene:Pglyrp1 / 21946 MGIID:1345092 Length:182 Species:Mus musculus


Alignment Length:164 Identity:68/164 - (41%)
Similarity:98/164 - (59%) Gaps:2/164 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 IVTRAEWNAKPPNGAIDSMETPLPRAVIAHTAGGACADDVTCSQHMQNLQNFQMSKQKFSDIGYH 86
            ||.|:||.|. |:.....:..|:...||:||||..|....:|.|..:|:|::..::..:.|:.|:
Mouse    20 IVPRSEWRAL-PSECSSRLGHPVRYVVISHTAGSFCNSPDSCEQQARNVQHYHKNELGWCDVAYN 83

  Fly    87 YLIGGNGKVYEGRSPSQRGAFAGPN-NDGSLGIAFIGNFEERAPNKEALDAAKELLEQAVKQAQL 150
            :|||.:|.|||||..:.:|...||. |..|:||.|:|||.:|.|.|.||.||..|||..|.:..|
Mouse    84 FLIGEDGHVYEGRGWNIKGDHTGPIWNPMSIGITFMGNFMDRVPAKRALRAALNLLECGVSRGFL 148

  Fly   151 VEGYKLLGHRQVSATKSPGEALYALIQQWPNWSE 184
            ...|::.|||.|.:|.|||:.||.:||.|.::.|
Mouse   149 RSNYEVKGHRDVQSTLSPGDQLYQVIQSWEHYRE 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SDNP_648145.1 PGRP 20..162 CDD:128941 57/140 (41%)
Pglyrp1NP_033428.1 PGRP 20..160 CDD:128941 57/140 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842393
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5479
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46811
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101717
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.620

Return to query results.
Submit another query.