DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SD and PGLYRP2

DIOPT Version :9

Sequence 1:NP_648145.1 Gene:PGRP-SD / 38858 FlyBaseID:FBgn0035806 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001350475.1 Gene:PGLYRP2 / 114770 HGNCID:30013 Length:634 Species:Homo sapiens


Alignment Length:162 Identity:56/162 - (34%)
Similarity:86/162 - (53%) Gaps:3/162 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RAEWNAKPPNGAIDSMETPLPRAVIAHTAGGA--CADDVTCSQHMQNLQNFQMSKQKFSDIGYHY 87
            |..|.|.|..|....::.||....:.||...|  |.|...|:.:|:::|.:....|.:.||||.:
Human   385 RCRWGAAPYRGRPKLLQLPLGFLYVHHTYVPAPPCTDFTRCAANMRSMQRYHQDTQGWGDIGYSF 449

  Fly    88 LIGGNGKVYEGRSPSQRGAFAGPNNDGSLGIAFIGNFEERAPNKEALDAAKELLEQ-AVKQAQLV 151
            ::|.:|.|||||.....||....:|....|:|.:||:....|.:.||...::.|.. ||:...|.
Human   450 VVGSDGYVYEGRGWHWVGAHTLGHNSRGFGVAIVGNYTAALPTEAALRTVRDTLPSCAVRAGLLR 514

  Fly   152 EGYKLLGHRQVSATKSPGEALYALIQQWPNWS 183
            ..|.||||||:..|..||:||:.|::.||:::
Human   515 PDYALLGHRQLVRTDCPGDALFDLLRTWPHFT 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SDNP_648145.1 PGRP 20..162 CDD:128941 47/139 (34%)
PGLYRP2NP_001350475.1 PGRP 380..525 CDD:128941 47/139 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152346
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101717
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.710

Return to query results.
Submit another query.