DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SD and pglyrp2

DIOPT Version :9

Sequence 1:NP_648145.1 Gene:PGRP-SD / 38858 FlyBaseID:FBgn0035806 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001106487.2 Gene:pglyrp2 / 100127677 XenbaseID:XB-GENE-5779913 Length:497 Species:Xenopus tropicalis


Alignment Length:166 Identity:56/166 - (33%)
Similarity:84/166 - (50%) Gaps:3/166 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 IVTRAEWNAKPPNGAIDSMETPLPRAVIAHT--AGGACADDVTCSQHMQNLQNFQMSKQKFSDIG 84
            ::.|..|.||...|....:..||.|..|.||  ....|.....|:.:|:::|.|....:.:.|||
 Frog   331 VIPRCMWGAKRYKGKPIFLGLPLSRVFIHHTYEPSQPCTSFSQCAANMRSMQRFHQQDRGWDDIG 395

  Fly    85 YHYLIGGNGKVYEGRSPSQRGAFAGPNNDGSLGIAFIGNFEERAPNKEALDAAKE-LLEQAVKQA 148
            |.:::|.||.:||||..::.||.....|....|::|||::....|....|...|: .|..||:..
 Frog   396 YSFVVGSNGYLYEGRGWNRAGAHTRGYNSVGYGVSFIGDYTSIVPKDSILALVKDRFLRCAVRLG 460

  Fly   149 QLVEGYKLLGHRQVSATKSPGEALYALIQQWPNWSE 184
            .:...|.:.|||||.:|..||:|||..||.|.::.|
 Frog   461 YITPNYIIQGHRQVVSTSCPGDALYKEIQSWDHFKE 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SDNP_648145.1 PGRP 20..162 CDD:128941 44/142 (31%)
pglyrp2NP_001106487.2 PGRP 329..474 CDD:128941 44/142 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.