DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33965 and YKL091C

DIOPT Version :9

Sequence 1:NP_001033983.1 Gene:CG33965 / 3885668 FlyBaseID:FBgn0053965 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_012832.1 Gene:YKL091C / 853771 SGDID:S000001574 Length:310 Species:Saccharomyces cerevisiae


Alignment Length:279 Identity:60/279 - (21%)
Similarity:114/279 - (40%) Gaps:49/279 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SPNSIRPLPPGLQKVAIEELNEVPSRVESDIAALKEWLQKQPHLCACLEDQFLLSFLRGSKFSLE 69
            |||::...|..|.|...|.|.:..|     |...|.:.::       |:|..||.|||..||.:.
Yeast    14 SPNALPGTPGNLTKEQEEALLQFRS-----ILLEKNYKER-------LDDSTLLRFLRARKFDIN 66

  Fly    70 KAKQ---KIDRF---YSLQAVIPEVFNDQRLVDNAQVLEIIRLGVIL----------RIPLDEED 118
            .:.:   :.:|:   |....:|.:..|::...|.    |.|:|..:.          ..||..|:
Yeast    67 ASVEMFVETERWREEYGANTIIEDYENNKEAEDK----ERIKLAKMYPQYYHHVDKDGRPLYFEE 127

  Fly   119 TGPAVTIIRAGSYDINKFKFQDIIRVGSMFGEIMMLEDDNASVSGYL-----EIMDMSGVTGANL 178
            .| .:.:.:.......|...:::::...:|....:......  :|||     .::|:.|::.:|.
Yeast   128 LG-GINLKKMYKITTEKQMLRNLVKEYELFATYRVPACSRR--AGYLIETSCTVLDLKGISLSNA 189

  Fly   179 FALQPQLLSKFSAYADEAM---PTRQKGIHFINVPKAFETGFKSLLGWFPGKIKERVSV--SSDP 238
            :    .:||.....||.:.   |.|....:.|:.|..|.|.||.:..:.......::.:  ||..
Yeast   190 Y----HVLSYIKDVADISQNYYPERMGKFYIIHSPFGFSTMFKMVKPFLDPVTVSKIFILGSSYK 250

  Fly   239 EAIFERVPKHYLPEEYGGS 257
            :.:.:::|...||.:|||:
Yeast   251 KELLKQIPIENLPVKYGGT 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33965NP_001033983.1 CRAL_TRIO_N 32..77 CDD:215024 11/47 (23%)
SEC14 101..256 CDD:238099 33/174 (19%)
YKL091CNP_012832.1 CRAL_TRIO_N 30..75 CDD:215024 14/56 (25%)
SEC14 101..271 CDD:214706 35/176 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.