DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33965 and SFH5

DIOPT Version :9

Sequence 1:NP_001033983.1 Gene:CG33965 / 3885668 FlyBaseID:FBgn0053965 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_012390.1 Gene:SFH5 / 853296 SGDID:S000003681 Length:294 Species:Saccharomyces cerevisiae


Alignment Length:254 Identity:54/254 - (21%)
Similarity:92/254 - (36%) Gaps:64/254 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 FYSLQAVIPEVFNDQRLVDNAQVLEIIRLGVILRIPLDEEDTGPAVTIIRAGSYDINKFKFQDI- 141
            |..|.....||.|          .|:..:| ||....:.:....|||....|.....|..||:: 
Yeast    89 FNPLSCAYKEVHN----------TELQNVG-ILTFDANGDANKKAVTWNLYGQLVKKKELFQNVD 142

  Fly   142 ----IRVGSMFGEIMMLEDDNASVSGYL-EIMDMSGVT----GANLFALQPQLLSKFSAYADEAM 197
                .|:|.|...:.:| |..:|.:.|: ::.|..||:    .:::......::..|..|..|.:
Yeast   143 KFVRYRIGLMEKGLSLL-DFTSSDNNYMTQVHDYKGVSVWRMDSDIKNCSKTVIGIFQKYYPELL 206

  Fly   198 PTRQKGIHFINVPKAFETGFKSLLGWFPGKIKERVSVSSDPEAIFERVPKHYLPEEYGGSKGTMK 262
            ..:    :|:|||..|        ||....||:.|.         |...|.::....|...|   
Yeast   207 YAK----YFVNVPTVF--------GWVYDLIKKFVD---------ETTRKKFVVLTDGSKLG--- 247

  Fly   263 DITDQMEAKLCSYRSYFEDCQH--FGAHDKLRE--EASVLNPDESHFGVDGSFRQLVID 317
                          .|.:||.:  :|..||...  :.:|.|...:.:|:....:|::.|
Yeast   248 --------------QYLKDCPYEGYGGKDKKNNLTKQNVTNVHPTEYGLYILQKQIIED 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33965NP_001033983.1 CRAL_TRIO_N 32..77 CDD:215024
SEC14 101..256 CDD:238099 36/164 (22%)
SFH5NP_012390.1 SEC14 101..263 CDD:214706 43/211 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.