DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33965 and TTPA

DIOPT Version :9

Sequence 1:NP_001033983.1 Gene:CG33965 / 3885668 FlyBaseID:FBgn0053965 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_000361.1 Gene:TTPA / 7274 HGNCID:12404 Length:278 Species:Homo sapiens


Alignment Length:260 Identity:72/260 - (27%)
Similarity:125/260 - (48%) Gaps:17/260 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 QKVAIEELNEVPSR---VESDIAALKEWLQKQ--PHLCACLEDQFLLSFLRGSKFSLEKAKQKID 76
            |..|..:||.:|..   ::..:|||:...::.  |.....|.|.|||.|||...|.|:.|.:.:.
Human     7 QPSAGPQLNALPDHSPLLQPGLAALRRRAREAGVPLAPLPLTDSFLLRFLRARDFDLDLAWRLLK 71

  Fly    77 RFYSLQAVIPEVFNDQRLVDNAQVLEIIRLGV--ILRIPLDEEDTGPAVTIIRAGSYDINKFKFQ 139
            .:|..:|..||:..|   :....::.:::.|.  :||   ..:.||..|.|.|...:|...|...
Human    72 NYYKWRAECPEISAD---LHPRSIIGLLKAGYHGVLR---SRDPTGSKVLIYRIAHWDPKVFTAY 130

  Fly   140 DIIRVGSMFGEIMMLEDDNASVSGYLEIMDMSGVTGANLFALQPQLLSKFSAYADEAMPTRQKGI 204
            |:.||..:..|:::.|.:... :|...|.|:.|...::.|.:.|.:..|.:|...::.|.:.:||
Human   131 DVFRVSLITSELIVQEVETQR-NGIKAIFDLEGWQFSHAFQITPSVAKKIAAVLTDSFPLKVRGI 194

  Fly   205 HFINVPKAFETGFKSLLGWFPGKIKERVSVSSD--PEAIFERVPKHYLPEEYGGSKGTMKDITDQ 267
            |.||.|..|...|..:..:...|||||:.:..:  .:::.:..| ..||.||||.:.:|:||..:
Human   195 HLINEPVIFHAVFSMIKPFLTEKIKERIHMHGNNYKQSLLQHFP-DILPLEYGGEEFSMEDICQE 258

  Fly   268  267
            Human   259  258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33965NP_001033983.1 CRAL_TRIO_N 32..77 CDD:215024 15/46 (33%)
SEC14 101..256 CDD:238099 42/158 (27%)
TTPANP_000361.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20 5/12 (42%)
CRAL_TRIO_N <40..73 CDD:215024 12/32 (38%)
CRAL_TRIO 99..248 CDD:395525 43/153 (28%)
Phosphatidylinositol 3,4-bisphosphate binding. /evidence=ECO:0000250|UniProtKB:Q8BWP5 190..192 0/1 (0%)
Phosphatidylinositol 4,5-bisphosphate binding. /evidence=ECO:0000250|UniProtKB:Q8BWP5 208..211 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.